Skip to the beginning of the images gallery

Recombinant Human KRAS (G12C) Protein

COA

Grade & Purity:

Carrier Free

≥95%(SDS-PAGE)

Expression System: E. coli
Accession #: P01116-2
Protein Tag: N-His
Bioactivity: The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp192043

Grouped product items
SKU	Size	Availability	Price
rp192043-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$69.90
rp192043-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$199.90
rp192043-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$319.90
rp192043-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,139.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 2-185 aa (G12C)

View related series

Click to view protein information: KRAS

Accession#: P01116-2 (11) Gene ID: 3845 (12) KRAS (55) KRAS (G12C) (2)

Basic Description

Product Name	Recombinant Human KRAS (G12C) Protein
Synonyms	AEP \| C-K-RAS Protein \| c-Ki-ras Protein \| c-Ki-ras2 Protein \| CFC2 Protein \| K-Ras Protein \| K-Ras 2 Protein \| K-RAS2A Protein \| K-RAS2B Protein \| K-RAS4A Protein \| K-RAS4B Protein \| KI-RAS Protein \| KRAS1 Protein \| KRAS2 Protein \| NS Protein \| NS3 Prote
Grade	Carrier Free
Specifications & Purity	Carrier Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms	K-Ras belongs to the small GTPase superfamily, Ras family. Like other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isopreny
Bioactivity	The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	2-185 aa (G12C)
Sequence	MHHHHHHTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Protein Tag	N-His
Accession #	P01116-2
Predicted molecular weight	21.9 kDa
SDS-PAGE	21.6 kDa, under reducing conditions; 21.6 kDa, under non-reducing conditions
Molecule Type	Protein

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human KRAS (G12C) Protein (rp192043)

Recombinant Human KRAS (G12C) Protein (rp192043) - SDS-PAGE
3 μg/lane of Recombinant Human KRAS (G12C) Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 21.6 kDa under reducing conditions and 21.6 kDa under non-reducing conditions.

Enzyme Activity: Recombinant Human KRAS(G12C) Protein (rp192043)

Recombinant Human KRAS(G12C) Protein - Enzyme Activity
The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration