This is a demo store. No orders will be fulfilled.

Recombinant Human KRAS (G12C, Q61H) Protein

  • Expression System: E. coli
  • Accession #: P01116-2
  • Protein Tag: N-His
  • Bioactivity: The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp192051
Grouped product items
SKU Size
Availability
Price Qty
rp192051-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
rp192051-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$249.90
rp192051-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
rp192051-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,139.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 1-185 aa (G12C, Q61H)

Basic Description

Product Name Recombinant Human KRAS (G12C, Q61H) Protein
Synonyms C-K-RAS Protein | c-Ki-ras Protein | c-Ki-ras2 Protein | CFC2 Protein | K-Ras Protein | K-Ras 2 Protein | K-RAS2A Protein | K-RAS2B Protein | K-RAS4A Protein | K-RAS4B Protein | KI-RAS Protein | KRAS1 Protein | KRAS2 Protein | RASK2 Protein | NS Protein |
Grade Carrier Free
Specifications & Purity Carrier Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms K-Ras belongs to the small GTPase superfamily, Ras family. Like other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isopreny
Bioactivity The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
Endotoxin Concentration <1.0 EU/μg
Expression System E. coli
Amino Acids 2-185 aa (G12C, Q61H)
Sequence MHHHHHHTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Protein Tag N-His
Accession # P01116-2
Predicted molecular weight 21.9 kDa
SDS-PAGE 23.2 kDa, under reducing conditions; 23.2 kDa, under non-reducing conditions
Molecule Type Protein

Storage and Shipping

Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Recombinant Human KRAS (G12C, Q61H) Protein (rp192051) - SDS-PAGE
3 μg/lane of Recombinant Human KRAS (G12C, Q61H) Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 23.2 kDa under reducing conditions and 23.2 kDa under non-reducing conditions.

Recombinant Human KRAS(G12C, Q61H) Protein - Enzyme Activity
The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Alternative Products

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.