Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp192051-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$89.90
|
|
|
rp192051-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$249.90
|
|
|
rp192051-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$399.90
|
|
|
rp192051-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,139.90
|
|
Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 1-185 aa (G12C, Q61H)
| Product Name | Recombinant Human KRAS (G12C, Q61H) Protein |
|---|---|
| Synonyms | C-K-RAS Protein | c-Ki-ras Protein | c-Ki-ras2 Protein | CFC2 Protein | K-Ras Protein | K-Ras 2 Protein | K-RAS2A Protein | K-RAS2B Protein | K-RAS4A Protein | K-RAS4B Protein | KI-RAS Protein | KRAS1 Protein | KRAS2 Protein | RASK2 Protein | NS Protein | |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | K-Ras belongs to the small GTPase superfamily, Ras family. Like other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isopreny |
| Bioactivity | The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-185 aa (G12C, Q61H) |
| Sequence | MHHHHHHTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC |
| Protein Tag | N-His |
| Accession # | P01116-2 |
| Predicted molecular weight | 21.9 kDa |
| SDS-PAGE | 23.2 kDa, under reducing conditions; 23.2 kDa, under non-reducing conditions |
| Molecule Type | Protein |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Recombinant Human KRAS (G12C, Q61H) Protein (rp192051) - SDS-PAGE
3 μg/lane of Recombinant Human KRAS (G12C, Q61H) Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 23.2 kDa under reducing conditions and 23.2 kDa under non-reducing conditions.
Recombinant Human KRAS(G12C, Q61H) Protein - Enzyme Activity
The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
Starting at $79.90
Starting at $89.90
Starting at $89.90
Starting at $69.90
Starting at $79.90
Starting at $69.90
Starting at $89.90
Starting at $89.90
Starting at $79.90
Starting at $89.90