This is a demo store. No orders will be fulfilled.

 
Call +1 (833) 552-7181 or Contact us
Toggle Nav
My Cart
Search
Advanced Search
Menu
Account
Settings
྾
main product photo

Recombinant Human EGF Protein (Biotin)

COA COA
  • Expression System: Pichia pastoris
  • Accession #: P01133
  • Protein Tag: No tag
  • Bioactivity: Binding EGFR
In stock
Item Number
rp170191
Grouped product items
SKU Size
Availability
 Price Qty
rp170191-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$599.90
rp170191-20μg
20μg
3
$999.90
Wish List
Bulk Order  SDS  DATASHEET  Specification Sheet

EGF-Biotin, Active, Pichia pastoris, No tag, 971-1021 aa

View related series
Click to view protein information: EGF
Accession#:P01133 (9) EGF (9) Gene ID:1950 (9)

Basic Description

Product Name Recombinant Human EGF Protein (Biotin)
Synonyms beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | epidermal growth factor | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone | EGF
Grade ActiBioPure™, Azide Free, Bioactive
Product Description

Introduction:
Epidermal growth factor (EGF) is a hormone that stimulates division of epidermal and other cells. Labeling with biotinylated EGF can be followed by second-step labeling with streptavidin conjugates. Biotinylated EGF has enabled researchers to investigate receptor-membrane interactions, study receptor distribution, calculate rate constants for the interaction of EGF with its receptor, and more.
Conjugation:
The EGF was conjugated with Biotin under optimum conditions, and unreacted Biotin was removed.
Recommended Usage：
Fluorescence is typically monitored using a flow cytometer, fluorescence microscope, or fluorimeter. For immunofluorescent staining, the recommended use of this reagent is ≤ 0.5µg per million cells in 100 µl staining volume. It is recommended that the reagent be titrated for optimal performance for different cell lines.
Specifications & Purity ActiBioPure™, Azide Free, Bioactive
Bioactivity Binding EGFR
Expression System Pichia pastoris
Species Human
Amino Acids 971 - 1021 aa
Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Protein Tag No tag
Conjugation Biotin
Accession # P01133

Storage and Shipping

Shape Lyophilized
Reconstitution This product should be reconstituted in 100μL of deionized water to make a 0.2mg/mL stock solution. Prepare working dilution on day of use. Stock solution is stable for about 8 weeks at 2-8°C as an undiluted liquid. Avoid freeze-thaw cycles. Protect from light.
Storage Temp Store at 2-8°C,Protected from light
Shipped In Wet ice
Stability And Storage The lyophilized products should be stored at –20°C until use. Allow the product to warm to room temperature before opening. Protect from light. When stored properly, the products should be stable for at least 12 months.

Images

Recombinant Human EGF Protein (Biotin) (rp170191) - Flow Cytometry
Flow analysis of EGF receptors (red line) in A431 Cells. Cells were labeled with Recombinant Human EGF Protein (Biotin) (rp170191) at 1/2500 dilution for 1 hour at 4°C, and then incubated with Streptavidin protein (APC) (np169048) at a dilution of 1/400 for 30 minutes at 4°C in the dark. Unlabeled Cells (black line) were used as a negative control.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot Number Certificate Type Date Item
ZJ23R0700042 Certificate of Analysis Jul 17, 2023 rp170191

Alternative Products

  1. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $14.90

  2. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $119.90

  3. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $19.90

  4. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $19.90

  5. Recombinant Human EGF Protein (FITC)
    Recombinant Human EGF Protein (FITC)

    Starting at $599.90

  6. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $119.90

  7. Recombinant Human EGF Protein
    Recombinant Human EGF Protein

    Starting at $69.90

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.