Skip to the beginning of the images gallery

Recombinant Human EGF Protein (FITC)

Grade & Purity:

Expression System: Pichia pastoris
Accession #: P01133
Protein Tag: No tag
Bioactivity: Binding EGFR

In stock

Item Number

rp170192

Grouped product items
SKU	Size	Availability	Price	Qty
rp170192-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$599.90
rp170192-20μg	20μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$999.90

EGF-FITC, Active, Pichia pastoris, No tag, 971-1021aa

View related series

Click to view protein information: EGF

Accession#:P01133 (9) EGF (9) FITC (181) Gene ID:1950 (9)

Basic Description

Product Name	Recombinant Human EGF Protein (FITC)
Synonyms	beta-urogastrone \| EGF \| epidermal growth factor (beta-urogastrone) \| epidermal growth factor \| hEGF \| HOMG4 \| pro-epidermal growth factor \| URG \| Urogastrone \| EGF
Grade	ActiBioPure™, Azide Free, Bioactive, Em:517nm, Ex:498nm
Product Description	Introduction: Epidermal growth factor (EGF) is a hormone that stimulates division of epidermal and other cells. EGF (FITC) conjugate, which remains fully active after conjugation and can be used to study EGF receptor in cells. Fluorescently labeled EGF has enabled researchers to investigate receptor-membrane interactions, study receptor distribution, calculate rate constants for the interaction of EGF with its receptor, and more. Conjugation: The EGF was conjugated with FITC under optimum conditions, and unreacted FITC was removed. The number of fluorophore molecules on each EGF molecule is 1.0. Recommended Usage： Fluorescence is typically monitored using a flow cytometer, fluorescence microscope, or fluorimeter. For immunofluorescent staining, the recommended use of this reagent is ≤ 0.5µg per million cells in 100 µl staining volume. It is recommended that the reagent be titrated for optimal performance for different cell lines.
Specifications & Purity	ActiBioPure™, Azide Free, Bioactive, Ex:498nm, Em:517nm
Bioactivity	Binding EGFR
Expression System	Pichia pastoris
Species	Human
Amino Acids	971-1021 aa
Sequence	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Protein Tag	No tag
Conjugation	FITC
Excitation(nm)	Blue Laser(488nm)
Emission(nm)	517nm
Ex/Em(nm)
Accession #	P01133

Storage and Shipping

Shape	Lyophilized
Reconstitution	This product should be reconstituted in 100μL of deionized water to make a 0.2mg/mL stock solution. Prepare working dilution on day of use. Stock solution is stable for about 8 weeks at 2-8°C as an undiluted liquid. Avoid freeze-thaw cycles. Protect fluorescent conjugates from light.
Storage Temp	Protected from light,Store at -20°C
Shipped In	Ice chest + Ice pads
Stability And Storage	The lyophilized products should be stored at –20°C until use. Allow the product to warm to room temperature before opening. Protect from light. When stored properly, the products should be stable for at least 12 months.

Images

Flow Cytometry: Recombinant Human EGF Protein (FITC) (rp170192)

Recombinant Human EGF Protein (FITC) (rp170192) - Flow Cytometry
Flow analysis of EGF receptors (red line) in A431 Cells. Cells were labeled with Recombinant Human EGF Protein (FITC) (rp170192). Unlabeled A431 Cells (black line) were used as a negative control.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot Number	Certificate Type	Date	Item
ZJ23R0700043	Certificate of Analysis	Jul 17, 2023	rp170192

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration