This is a demo store. No orders will be fulfilled.

Recombinant Mouse GM-CSF Protein, ≥95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: Q14AD9
  • Protein Tag: N-His
  • Bioactivity: Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is typically 0.04-0.17 ng/mL, corresponding to a specific activity of 5.88×10^6~2.5×10^7 units/mg.
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp154039
Grouped product items
SKU Size
Availability
Price Qty
rp154039-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$79.90
rp154039-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$279.90
rp154039-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$449.90
rp154039-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,799.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, N-His tag, 18-141 aa

Basic Description

Product Name Recombinant Mouse GM-CSF Protein, ≥95% (SDS-PAGE), high purity
Synonyms colony stimulating factor 2 (granulocyte-macrophage) | Colony-stimulating factor | CSF | CSF2 | CSF-2 | GMCSF | GM-CSF | GMCSFgranulocyte-macrophage colony-stimulating factor | granulocyte-macrophage colony stimulating factor | MGC131935 | MGC138897 | Mol
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity ≥95% (SDS-PAGE)
Bioactivity Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is typically 0.04-0.17 ng/mL, corresponding to a specific activity of 5.88×10^6~2.5×10^7 units/mg.
Endotoxin Concentration <0.1 EU/μg
Expression System HEK293
Species Mouse
Amino Acids 18-141 aa
Sequence HHHHHHAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Protein Tag N-His
Accession # Q14AD9
Predicted molecular weight 15 kDa
SDS-PAGE 16.0 - 31.5 kDa, under reducing conditions; 14.5 - 30.0 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Mouse GM-CSF Protein (rp154039) - Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is 0.17 ng/mL.

Recombinant Mouse GM-CSF Protein (rp154039) - SDS-PAGE
3 μg/lane of Recombinant Mouse GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.0 - 31.5 kDa under reducing condition and 14.5 - 30.0 kDa under non-reducing condition.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot Number Certificate Type Date Item
ZJ24F1215493 Certificate of Analysis Dec 19, 2024 rp154039

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.