Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp154039-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$79.90
|
|
|
rp154039-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$279.90
|
|
|
rp154039-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$449.90
|
|
|
rp154039-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,799.90
|
|
Animal Free, ≥95% (SDS-PAGE), Active, 293F, N-His tag, 18-141 aa
| Product Name | Recombinant Mouse GM-CSF Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | colony stimulating factor 2 (granulocyte-macrophage) | Colony-stimulating factor | CSF | CSF2 | CSF-2 | GMCSF | GM-CSF | GMCSFgranulocyte-macrophage colony-stimulating factor | granulocyte-macrophage colony stimulating factor | MGC131935 | MGC138897 | Mol |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is typically 0.04-0.17 ng/mL, corresponding to a specific activity of 5.88×10^6~2.5×10^7 units/mg. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 18-141 aa |
| Sequence | HHHHHHAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK |
| Protein Tag | N-His |
| Accession # | Q14AD9 |
| Predicted molecular weight | 15 kDa |
| SDS-PAGE | 16.0 - 31.5 kDa, under reducing conditions; 14.5 - 30.0 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Shape | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Mouse GM-CSF Protein (rp154039) - Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is 0.17 ng/mL.
Recombinant Mouse GM-CSF Protein (rp154039) - SDS-PAGE
3 μg/lane of Recombinant Mouse GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.0 - 31.5 kDa under reducing condition and 14.5 - 30.0 kDa under non-reducing condition.
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
| Certificate of Analysis | Dec 19, 2024 | rp154039 |