Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp181315-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$139.90
|
|
|
rp181315-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$399.90
|
|
|
rp181315-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$629.90
|
|
|
rp181315-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 24-99 aa
| Product Name | Recombinant Human CCL8/MCP-2 Protein |
|---|---|
| Synonyms | C-C motif chemokine 8 | CCL8 | chemokine (C-C motif) ligand 8 | HC14 | MCP2 | MCP-2 | member 8 (monocyte chemotactic protein 2) | monocyte chemoattractant protein 2 | SCYA10 | small-inducible cytokine A8 |
| Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
| Specifications & Purity | ActiBioPure™, Carrier Free, Bioactive, High performance, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensio |
| Bioactivity | Determined by its ability to chemoattract PBMC using a concentration range of 10.0-100.0 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 24-99 aa |
| Sequence | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Protein Tag | No tag |
| Accession # | P80075 |
| Predicted molecular weight | 8.9 kDa |
| SDS-PAGE | 10.3 kDa, under reducing conditions; 10.3&17.8 kDa, under non-reducing conditions |
| Molecule Type | Protein |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Recombinant Human CCL8/MCP-2 Protein (rp181315) - Protein Bioactivity
Determined by its ability to chemoattract PBMC using a concentration range of 10.0-100.0 ng/mL.
Recombinant Human CCL8/MCP-2 Protein (rp181315) - SDS-PAGE
1.5 μg/lane of Recombinant Human CCL8/MCP-2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.3 kDa under reducing conditions and 10.3 & 17.8 kDa under non-reducing conditions.
Starting at $69.90