This is a demo store. No orders will be fulfilled.

Recombinant Human CCL8/MCP-2 Protein

  • Expression System: E. coli
  • Accession #: P80075
  • Protein Tag: No tag
  • Bioactivity: Determined by its ability to chemoattract PBMC using a concentration range of 10.0-100.0 ng/mL.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp181315
Grouped product items
SKU Size
Availability
Price Qty
rp181315-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$139.90
rp181315-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
rp181315-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$629.90
rp181315-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90

Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 24-99 aa

Basic Description

Product Name Recombinant Human CCL8/MCP-2 Protein
Synonyms C-C motif chemokine 8 | CCL8 | chemokine (C-C motif) ligand 8 | HC14 | MCP2 | MCP-2 | member 8 (monocyte chemotactic protein 2) | monocyte chemoattractant protein 2 | SCYA10 | small-inducible cytokine A8
Grade ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity ActiBioPure™, Carrier Free, Bioactive, High performance, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensio
Bioactivity Determined by its ability to chemoattract PBMC using a concentration range of 10.0-100.0 ng/mL.
Endotoxin Concentration <1.0 EU/μg
Expression System E. coli
Amino Acids 24-99 aa
Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Protein Tag No tag
Accession # P80075
Predicted molecular weight 8.9 kDa
SDS-PAGE 10.3 kDa, under reducing conditions; 10.3&17.8 kDa, under non-reducing conditions
Molecule Type Protein

Storage and Shipping

Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Recombinant Human CCL8/MCP-2 Protein (rp181315) - Protein Bioactivity
Determined by its ability to chemoattract PBMC using a concentration range of 10.0-100.0 ng/mL.

Recombinant Human CCL8/MCP-2 Protein (rp181315) - SDS-PAGE
1.5 μg/lane of Recombinant Human CCL8/MCP-2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.3 kDa under reducing conditions and 10.3 & 17.8 kDa under non-reducing conditions.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.