This is a demo store. No orders will be fulfilled.

SFRP1

Description Secreted frizzled-related protein 1

Gene and Protein Information

Gene ID 6422
Uniprot Accession IDs Q8N474 O00546 O14779 FRP-1
Ensembl ID ENSG00000104332
Symbol FRP FRP1 SARP2 FRP FRP1 FrzA FRP-1 SARP2
Chromosome 8
Family Belongs to the secreted frizzled-related protein (sFRP) family.
Sequence
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 736186 SFRP1 secreted frizzled related protein 1 9598 VGNC:10329 OMA, EggNOG
Macaque 702876 SFRP1 secreted frizzled related protein 1 9544 Inparanoid, OMA, EggNOG
Mouse 20377 Sfrp1 secreted frizzled-related protein 1 10090 MGI:892014 Inparanoid, OMA, EggNOG
Rat 84402 Sfrp1 secreted frizzled-related protein 1 10116 RGD:621074 OMA, EggNOG
Dog 482844 SFRP1 secreted frizzled related protein 1 9615 VGNC:46080 Inparanoid, OMA, EggNOG
Horse SFRP1 secreted frizzled related protein 1 [Source:HGNC Symbol;Acc:HGNC:10776] 9796 OMA, EggNOG
Cow 282068 SFRP1 secreted frizzled related protein 1 9913 VGNC:34520 Inparanoid, OMA, EggNOG
Opossum 100033009 SFRP1 secreted frizzled related protein 1 13616 Inparanoid, EggNOG
Chicken 395237 SFRP1 secreted frizzled related protein 1 9031 CGNC:2531 Inparanoid, OMA, EggNOG
Xenopus 100038100 sfrp1 secreted frizzled-related protein 1 8364 XB-GENE-488230 Inparanoid, OMA, EggNOG
Zebrafish 402843 sfrp1a secreted frizzled-related protein 1a 7955 ZDB-GENE-040310-5 OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.