This is a demo store. No orders will be fulfilled.
| Description | Taste receptor type 2 member 43 |
|---|
Gene and Protein Information
| Gene ID | 259289 |
|---|---|
| Uniprot Accession IDs | P59537 P59546 Q645X4 T2R43 |
| Ensembl ID | ENSG00000255374 |
| Symbol | T2R43 T2R52 |
| Chromosome | 12 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence |
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLHLKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAIYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYWVKGEKTSSP
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 353165 | Tas2r136 | taste receptor, type 2, member 136 | 10090 | MGI:2681304 | OMA, EggNOG |
| Rat | 100310876 | Tas2r136 | taste receptor, type 2, member 136 | 10116 | RGD:2314262 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 43
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 43
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later