The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
SLC6A4
| Description |
Sodium-dependent serotonin transporter
|
Gene and Protein Information
| Gene ID |
6532
|
| Uniprot Accession IDs |
P31645
Q5EE02
SERT
|
| Ensembl ID |
ENSG00000108576
|
| Symbol |
HTT
SERT
HTT
5HTT
OCD1
SERT
5-HTT
SERT1
hSERT
5-HTTLPR
|
| Chromosome |
17
|
| Family |
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily. |
| Sequence |
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
468201 |
SLC6A4 |
solute carrier family 6 member 4 |
9598 |
VGNC:9626 |
OMA, EggNOG |
| Macaque |
574140 |
SLC6A4 |
solute carrier family 6 member 4 |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
15567 |
Slc6a4 |
solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
10090 |
MGI:96285 |
Inparanoid, OMA, EggNOG |
| Rat |
25553 |
Slc6a4 |
solute carrier family 6 member 4 |
10116 |
RGD:3714 |
Inparanoid, OMA, EggNOG |
| Dog |
491184 |
SLC6A4 |
solute carrier family 6 member 4 |
9615 |
VGNC:46465 |
Inparanoid, OMA, EggNOG |
| Horse |
100033848 |
SLC6A4 |
solute carrier family 6 member 4 |
9796 |
VGNC:23261 |
OMA, EggNOG |
| Cow |
282365 |
SLC6A4 |
solute carrier family 6 member 4 |
9913 |
VGNC:49971 |
Inparanoid, OMA, EggNOG |
| Pig |
100517307 |
SLC6A4 |
solute carrier family 6 member 4 |
9823 |
|
OMA, EggNOG |
| Opossum |
100015330 |
SLC6A4 |
solute carrier family 6 member 4 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
404747 |
SLC6A4 |
solute carrier family 6 member 4 |
9031 |
CGNC:3120 |
Inparanoid, OMA, EggNOG |
| Anole lizard |
100562250 |
slc6a4 |
solute carrier family 6 member 4 |
28377 |
|
Inparanoid, OMA, EggNOG |
| Zebrafish |
664719 |
slc6a4a |
solute carrier family 6 (neurotransmitter transporter), member 4a |
7955 |
ZDB-GENE-060314-1 |
Inparanoid, OMA |
| C. elegans |
171879 |
mod-5 |
Transporter |
6239 |
|
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.