This is a demo store. No orders will be fulfilled.
| Description | Probable G-protein coupled receptor 32 |
|---|
Gene and Protein Information
| Gene ID | 2854 |
|---|---|
| Uniprot Accession IDs | O75388 Q502U7 Q6NWS5 |
| Ensembl ID | ENSG00000142511 |
| Symbol | RVDR1 |
| Chromosome | 19 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence |
MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748574 | GPR32 | G protein-coupled receptor 32 | 9598 | VGNC:11123 | OMA, EggNOG |
| Pig | GPR32 | G protein-coupled receptor 32 [Source:HGNC Symbol;Acc:HGNC:4487] | 9823 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Probable G-protein coupled receptor 32
protein / receptor / G-protein coupled receptor / Probable G-protein coupled receptor 32
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Probable G-protein coupled receptor 32
protein / G-protein coupled receptor / Class A rhodopsin like / Probable G-protein coupled receptor 32
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later