JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FABP5

Description	Fatty acid-binding protein 5

Gene and Protein Information

Gene ID	2171
Uniprot Accession IDs	Q01469 B2R4K0
Ensembl ID	ENSG00000164687
Symbol	EFABP KFABP E-FABP PAFABP PA-FABP
Chromosome	8
Family	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence	MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746909	FABP5	fatty acid binding protein 5	9598	VGNC:6678	OMA, EggNOG
Mouse	16592	Fabp5	fatty acid binding protein 5, epidermal	10090	MGI:101790	Inparanoid, OMA, EggNOG
Rat	140868	Fabp5	fatty acid binding protein 5	10116	RGD:70997	Inparanoid, OMA, EggNOG
Horse	100057538	FABP5	fatty acid binding protein 5	9796		Inparanoid, OMA, EggNOG
Cow		FABP5	fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560]	9913		OMA, EggNOG
Pig	574074	FABP5	fatty acid binding protein 5	9823		Inparanoid, OMA, EggNOG
Opossum		FABP5	fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560]	13616		Inparanoid, OMA, EggNOG
Platypus	100075490	FABP5	fatty acid binding protein 5	9258		Inparanoid, OMA, EggNOG
Anole lizard	100555334	LOC100555334	fatty acid-binding protein, epidermal	28377		OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.