This is a demo store. No orders will be fulfilled.
| Description | High mobility group protein B1 |
|---|
Gene and Protein Information
| Gene ID | 3146 |
|---|---|
| Uniprot Accession IDs | P09429 A5D8W9 Q14321 Q5T7C3 Q6IBE1 |
| Ensembl ID | ENSG00000189403 |
| Symbol | HMG1 HMG1 HMG3 HMG-1 SBP-1 |
| Chromosome | 13 |
| Family | Belongs to the HMGB family. |
| Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 15289 | Hmgb1 | high mobility group box 1 | 10090 | MGI:96113 | Inparanoid, OMA, EggNOG |
| Rat | 108349189 | LOC108349189 | high mobility group protein B1 pseudogene | 10116 | RGD:11468204 | OMA, EggNOG |
| Dog | 403170 | HMGB1 | high mobility group box 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100033873 | HMGB1 | high mobility group box 1 | 9796 | Inparanoid, OMA | |
| Cow | 282691 | HMGB1 | high mobility group box 1 | 9913 | VGNC:53816 | Inparanoid, OMA |
| Pig | 445521 | HMGB1 | high mobility group box 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020248 | HMGB1 | high mobility group box 1 | 13616 | OMA, EggNOG | |
| Anole lizard | 100560708 | hmgb1 | high mobility group box 1 | 28377 | OMA, EggNOG | |
| Xenopus | 394834 | hmgb1 | high mobility group box 1 | 8364 | XB-GENE-1001206 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / chromatin/chromatin-binding protein / High mobility group protein B1
protein / nucleic acid binding / signaling molecule / High mobility group protein B1
protein / nucleic acid binding / HMG box transcription factor / High mobility group protein B1
protein / nucleic acid binding / chromatin/chromatin-binding protein / High mobility group protein B1
protein / nucleic acid binding / signaling molecule / High mobility group protein B1
protein / nucleic acid binding / HMG box transcription factor / High mobility group protein B1
DTO Classes
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / High mobility group protein B1
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / High mobility group protein B1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later