JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CCNB1

Description	G2/mitotic-specific cyclin-B1

Gene and Protein Information

Gene ID	891
Uniprot Accession IDs	P14635 A8K066 Q5TZP9
Ensembl ID	ENSG00000134057
Symbol	CCNB CCNB
Chromosome	5
Family	Belongs to the cyclin family. Cyclin AB subfamily.
Sequence	MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461835	CCNB1	cyclin B1	9598	VGNC:3935	OMA, EggNOG
Macaque	699504	CCNB1	cyclin B1	9544		Inparanoid, OMA, EggNOG
Mouse	268697	Ccnb1	cyclin B1	10090	MGI:88302	Inparanoid, OMA, EggNOG
Rat	25203	Ccnb1	cyclin B1	10116	RGD:2291	Inparanoid, OMA
Horse	100050093	CCNB1	cyclin B1	9796	VGNC:16204	Inparanoid, OMA, EggNOG
Cow	327679	CCNB1	cyclin B1	9913	VGNC:26958	Inparanoid, OMA, EggNOG
Pig	397662	CCNB1	cyclin B1	9823		Inparanoid, OMA, EggNOG
Opossum	100019387	CCNB1	cyclin B1	13616		Inparanoid, OMA, EggNOG
Platypus	100083344	CCNB1	cyclin B1	9258		Inparanoid, OMA, EggNOG
Anole lizard	100557278	ccnb1	cyclin B1	28377		Inparanoid, OMA, EggNOG
Xenopus	394726	ccnb1.2	cyclin B1	8364	XB-GENE-5736422	Inparanoid, OMA
Zebrafish	58025	ccnb1	cyclin B1	7955	ZDB-GENE-000406-10	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / kinase activator / G2/mitotic-specific cyclin-B1

DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / G2/mitotic-specific cyclin-B1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.