This is a demo store. No orders will be fulfilled.

 
Call +1 (833) 552-7181 or Contact us
Toggle Nav
My Cart
Search
Advanced Search
Menu
Account
Settings
྾

NAPEPLD

Description N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Gene and Protein Information

Gene ID 222236
Uniprot Accession IDs Q6IQ20 Q5CZ87 Q769K1 N-acyl phosphatidylethanolamine phospholipase D
Ensembl ID ENSG00000161048
Symbol C7orf18 FMP30 C7orf18 NAPE-PLD
Chromosome 7
Family Belongs to the NAPE-PLD family.
Sequence
MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 472476 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9598 VGNC:14052 OMA, EggNOG
Macaque 695318 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9544 Inparanoid, OMA, EggNOG
Mouse 242864 Napepld N-acyl phosphatidylethanolamine phospholipase D 10090 MGI:2140885 Inparanoid, OMA, EggNOG
Rat 296757 Napepld N-acyl phosphatidylethanolamine phospholipase D 10116 RGD:735197 Inparanoid, OMA, EggNOG
Dog 100685330 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9615 VGNC:43621 Inparanoid, OMA, EggNOG
Horse 100050247 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9796 VGNC:20561 Inparanoid, OMA, EggNOG
Cow 541291 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9913 VGNC:31883 Inparanoid, OMA, EggNOG
Pig 100737731 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9823 OMA, EggNOG
Opossum 100017822 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 13616 Inparanoid, OMA, EggNOG
Chicken 417719 NAPEPLD N-acyl phosphatidylethanolamine phospholipase D 9031 CGNC:50575 Inparanoid, OMA, EggNOG
Anole lizard 100559466 napepld N-acyl phosphatidylethanolamine phospholipase D 28377 Inparanoid, OMA, EggNOG
Xenopus 100494898 napepld N-acyl phosphatidylethanolamine phospholipase D 8364 XB-GENE-962615 Inparanoid, OMA, EggNOG
Zebrafish 568061 napepld N-acyl phosphatidylethanolamine phospholipase D 7955 ZDB-GENE-030131-3856 Inparanoid, OMA, EggNOG
C. elegans 177136 nape-2 N-Acyl Phosphatidyl Ethanolamine specific phospholipase D (NAPE-PLD) homolog 6239 Inparanoid, OMA, EggNOG
S.cerevisiae 856001 FMP30 N-acetylphosphatidylethanolamine-hydrolyzing phospholipase D 4932 S000006024 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.