JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

P2RX1

Description	P2X purinoceptor 1

Gene and Protein Information

Gene ID	5023
Uniprot Accession IDs	P51575 Q9UK84 P2X1
Ensembl ID	ENSG00000108405
Symbol	P2X1 P2X1
Chromosome	17
Family	Belongs to the P2X receptor family.
Sequence	MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454439	P2RX1	purinergic receptor P2X 1	9598	VGNC:9500	OMA, EggNOG
Macaque	707658	P2RX1	purinergic receptor P2X 1	9544		Inparanoid, OMA, EggNOG
Mouse	18436	P2rx1	purinergic receptor P2X, ligand-gated ion channel, 1	10090	MGI:1098235	Inparanoid, OMA, EggNOG
Rat	25505	P2rx1	purinergic receptor P2X 1	10116	RGD:3240	Inparanoid, OMA, EggNOG
Dog	491223	P2RX1	purinergic receptor P2X 1	9615	VGNC:44207	Inparanoid, OMA, EggNOG
Horse	100060689	P2RX1	purinergic receptor P2X 1	9796	VGNC:21106	Inparanoid, OMA, EggNOG
Cow	514898	P2RX1	purinergic receptor P2X 1	9913	VGNC:32517	OMA, EggNOG
Pig	106504105	P2RX1	purinergic receptor P2X 1	9823		OMA, EggNOG
Xenopus		P2RX1	purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533]	8364		OMA, EggNOG
Zebrafish	387296	p2rx1	purinergic receptor P2X, ligand-gated ion channel, 1	7955	ZDB-GENE-030319-1	Inparanoid, OMA, EggNOG

DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.