JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NOTUM

Description	Palmitoleoyl-protein carboxylesterase NOTUM

Gene and Protein Information

Gene ID	147111
Uniprot Accession IDs	Q6P988 Q8N410 Q8NI82
Ensembl ID	ENSG00000185269
Symbol	hNOTUM
Chromosome	17
Family	Belongs to the pectinacetylesterase family. Notum subfamily.
Sequence	MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100609059	NOTUM	notum, palmitoleoyl-protein carboxylesterase	9598	VGNC:9485	OMA, EggNOG
Mouse	77583	Notum	notum palmitoleoyl-protein carboxylesterase	10090	MGI:1924833	Inparanoid, OMA, EggNOG
Rat	303743	Notum	NOTUM, palmitoleoyl-protein carboxylesterase	10116	RGD:1307119	Inparanoid, OMA, EggNOG
Dog	483374	NOTUM	notum, palmitoleoyl-protein carboxylesterase	9615	VGNC:43901	Inparanoid, OMA, EggNOG
Horse	100054869	NOTUM	notum, palmitoleoyl-protein carboxylesterase	9796	VGNC:20820	Inparanoid, OMA, EggNOG
Opossum	100029923	NOTUM	notum, palmitoleoyl-protein carboxylesterase	13616		Inparanoid, OMA, EggNOG
Chicken	417385	NOTUM	NOTUM, palmitoleoyl-protein carboxylesterase	9031	CGNC:2094	Inparanoid, OMA, EggNOG
Anole lizard	100564438	notum	notum, palmitoleoyl-protein carboxylesterase	28377		Inparanoid, OMA, EggNOG
Xenopus	100145278	notum	notum, palmitoleoyl-protein carboxylesterase	8364	XB-GENE-996986	Inparanoid, OMA, EggNOG
Zebrafish	570510	notum1a	notum, palmitoleoyl-protein carboxylesterase a	7955	ZDB-GENE-120807-2	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.