JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CGA

Description	Glycoprotein hormones alpha chain

Gene and Protein Information

Gene ID	1081
Uniprot Accession IDs	P01215
Ensembl ID	ENSG00000135346
Symbol	HCG LHA FSHA GPHa TSHA GPHA1 CG-ALPHA
Chromosome	6
Family	Belongs to the glycoprotein hormones subunit alpha family.
Sequence	MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462868	CGA	glycoprotein hormones, alpha polypeptide	9598		OMA, EggNOG
Macaque	697859	CGA	glycoprotein hormones, alpha polypeptide	9544		Inparanoid, OMA, EggNOG
Mouse	12640	Cga	glycoprotein hormones, alpha subunit	10090	MGI:88390	Inparanoid, OMA, EggNOG
Rat	116700	Cga	glycoprotein hormones, alpha polypeptide	10116	RGD:620436	Inparanoid, OMA, EggNOG
Dog	403483	CGA	glycoprotein hormones, alpha polypeptide	9615	VGNC:39181	Inparanoid, OMA, EggNOG
Horse	100034174	CGA	glycoprotein hormones, alpha polypeptide	9796	VGNC:49352	Inparanoid, OMA, EggNOG
Cow	280749	CGA	glycoprotein hormones, alpha polypeptide	9913	VGNC:27257	Inparanoid, OMA, EggNOG
Pig	406869	CGA	glycoprotein hormones, alpha polypeptide	9823		Inparanoid, OMA, EggNOG
Opossum	554198	CGA	glycoprotein hormones, alpha polypeptide	13616		Inparanoid, OMA, EggNOG
Platypus		CGA	glycoprotein hormones, alpha polypeptide [Source:HGNC Symbol;Acc:HGNC:1885]	9258		OMA, EggNOG
Chicken	421829	CGA	glycoprotein hormones, alpha polypeptide	9031	CGNC:11808	Inparanoid, OMA, EggNOG
Xenopus	100488153	cga	glycoprotein hormones, alpha polypeptide	8364	XB-GENE-478483	Inparanoid, OMA, EggNOG
Zebrafish	402987	cga	glycoprotein hormones, alpha polypeptide	7955	ZDB-GENE-040715-2	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.