JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GCG

Description	Glucagon

Gene and Protein Information

Gene ID	2641
Uniprot Accession IDs	P01275 A6NN65 Q53TP6
Ensembl ID	ENSG00000115263
Symbol	GLP1 GLP2 GRPP GLP-1
Chromosome	2
Family	Belongs to the glucagon family.
Sequence	MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100609153	GCG	glucagon	9598	VGNC:439	OMA, EggNOG
Mouse	14526	Gcg	glucagon	10090	MGI:95674	Inparanoid, OMA, EggNOG
Rat	24952	Gcg	glucagon	10116	RGD:2668	Inparanoid, OMA, EggNOG
Dog	403571	GCG	glucagon	9615	VGNC:41143	Inparanoid, OMA, EggNOG
Horse	100051551	GCG	glucagon	9796	VGNC:18274	Inparanoid, OMA, EggNOG
Cow	280802	GCG	glucagon	9913	VGNC:29284	Inparanoid, OMA, EggNOG
Pig	397595	GCG	glucagon	9823		Inparanoid, OMA, EggNOG
Opossum	100015836	GCG	glucagon	13616		Inparanoid, OMA, EggNOG
Chicken	396196	GCG	glucagon	9031	CGNC:8432	Inparanoid, OMA
Xenopus	448760	gcg	glucagon	8364	XB-GENE-1000156	Inparanoid, OMA, EggNOG
Zebrafish	494052	gcga	glucagon a	7955	ZDB-GENE-010219-1	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.