This is a demo store. No orders will be fulfilled.
| Description | Endothelin-1 receptor |
|---|
Gene and Protein Information
| Gene ID | 1909 |
|---|---|
| Uniprot Accession IDs | P25101 B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2 |
| Ensembl ID | ENSG00000151617 |
| Symbol | ETA ETRA ETA ET-A ETAR ETRA MFDA ETA-R hET-AR |
| Chromosome | 4 |
| Family | Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. |
| Sequence |
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461530 | EDNRA | endothelin receptor type A | 9598 | VGNC:594 | OMA, EggNOG |
| Macaque | 704135 | EDNRA | endothelin receptor type A | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13617 | Ednra | endothelin receptor type A | 10090 | MGI:105923 | Inparanoid, OMA, EggNOG |
| Rat | 24326 | Ednra | endothelin receptor type A | 10116 | RGD:2535 | Inparanoid, OMA, EggNOG |
| Dog | 450187 | EDNRA | endothelin receptor type A | 9615 | VGNC:40202 | Inparanoid, OMA, EggNOG |
| Horse | 100062644 | EDNRA | endothelin receptor type A | 9796 | VGNC:17424 | Inparanoid, OMA, EggNOG |
| Cow | 281749 | EDNRA | endothelin receptor type A | 9913 | VGNC:28329 | Inparanoid, OMA, EggNOG |
| Pig | 397457 | EDNRA | endothelin receptor type A | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018535 | EDNRA | endothelin receptor type A | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079418 | EDNRA | endothelin receptor type A | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 373908 | EDNRA | endothelin receptor type A | 9031 | CGNC:7610 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559070 | ednra | endothelin receptor type A | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779728 | ednra | endothelin receptor type A | 8364 | XB-GENE-1006994 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114550 | ednraa | endothelin receptor type Aa | 7955 | ZDB-GENE-010906-2 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later