JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GRP

Description	Gastrin-releasing peptide

Gene and Protein Information

Gene ID	2922
Uniprot Accession IDs	P07492 P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP
Ensembl ID	ENSG00000134443
Symbol	BN GRP-10 proGRP preproGRP
Chromosome	18
Family	Belongs to the bombesin/neuromedin-B/ranatensin family.
Sequence	MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736808	GRP	gastrin releasing peptide	9598	VGNC:7316	OMA, EggNOG
Macaque	696983	GRP	gastrin releasing peptide	9544		OMA, EggNOG
Mouse	225642	Grp	gastrin releasing peptide	10090	MGI:95833	Inparanoid, OMA, EggNOG
Rat	171101	Grp	gastrin releasing peptide	10116	RGD:621740	Inparanoid, OMA, EggNOG
Dog	610154	GRP	gastrin releasing peptide	9615	VGNC:53721	OMA, EggNOG
Horse	100050124	GRP	gastrin releasing peptide	9796	VGNC:18608	Inparanoid, OMA, EggNOG
Cow	615323	GRP	gastrin releasing peptide	9913	VGNC:29664	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.