This is a demo store. No orders will be fulfilled.
| Description | Alpha-1B adrenergic receptor |
|---|
Gene and Protein Information
| Gene ID | 147 |
|---|---|
| Uniprot Accession IDs | P35368 B0LPE1 |
| Ensembl ID | ENSG00000170214 |
| Symbol | ADRA1 ALPHA1BAR |
| Chromosome | 5 |
| Family | Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1B sub-subfamily. |
| Sequence |
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736934 | ADRA1B | adrenoceptor alpha 1B | 9598 | VGNC:11727 | OMA, EggNOG |
| Mouse | 11548 | Adra1b | adrenergic receptor, alpha 1b | 10090 | MGI:104774 | Inparanoid, OMA, EggNOG |
| Rat | 24173 | Adra1b | adrenoceptor alpha 1B | 10116 | RGD:2054 | Inparanoid, OMA |
| Dog | 403962 | ADRA1B | adrenoceptor alpha 1B | 9615 | VGNC:37673 | Inparanoid, OMA, EggNOG |
| Horse | 100071055 | ADRA1B | adrenoceptor alpha 1B | 9796 | VGNC:15132 | Inparanoid, OMA, EggNOG |
| Cow | 407140 | ADRA1B | adrenoceptor alpha 1B | 9913 | VGNC:25694 | Inparanoid, OMA, EggNOG |
| Pig | 100519931 | ADRA1B | adrenoceptor alpha 1B | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025515 | ADRA1B | adrenoceptor alpha 1B | 13616 | Inparanoid, EggNOG | |
| Platypus | 100074819 | ADRA1B | adrenoceptor alpha 1B | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 373890 | ADRA1B | adrenoceptor alpha 1B | 9031 | CGNC:48942 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Adrenoceptor / Alpha adrenoceptor / Alpha-1B adrenergic receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Adrenoceptor / Alpha adrenoceptor / Alpha-1B adrenergic receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later