JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NPPB

Description	Natriuretic peptides B

Gene and Protein Information

Gene ID	4879
Uniprot Accession IDs	P16860 B0ZBE9 Q6FGY0 Q9P2Q7
Ensembl ID	ENSG00000120937
Symbol	BNP
Chromosome	1
Family	Belongs to the natriuretic peptide family.
Sequence	MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469801	NPPB	natriuretic peptide B	9598	VGNC:1418	OMA, EggNOG
Mouse	18158	Nppb	natriuretic peptide type B	10090	MGI:97368	Inparanoid, OMA, EggNOG
Rat	25105	Nppb	natriuretic peptide B	10116	RGD:3194	Inparanoid, OMA, EggNOG
Dog	487441	NPPB	natriuretic peptide B	9615	VGNC:43926	Inparanoid, OMA, EggNOG
Horse	100056123	NPPB	natriuretic peptide B	9796	VGNC:20845	Inparanoid, OMA, EggNOG
Cow	508734	NPPB	natriuretic peptide B	9913	VGNC:32211	Inparanoid, OMA, EggNOG
Pig	396844	NPPB	natriuretic peptide B	9823		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.