JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CXCL5

Description	C-X-C motif chemokine 5

Gene and Protein Information

Gene ID	6374
Uniprot Accession IDs	P42830 Q96QE1
Ensembl ID	ENSG00000163735
Symbol	ENA78 SCYB5 SCYB5 ENA-78
Chromosome	4
Family	Belongs to the intercrine alpha (chemokine CxC) family.
Sequence	MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	740377	CXCL5	C-X-C motif chemokine ligand 5	9598	VGNC:8663	OMA, EggNOG
Mouse	20311	Cxcl5	chemokine (C-X-C motif) ligand 5	10090	MGI:1096868	Inparanoid, OMA
Dog	106557449	LOC106557449	alveolar macrophage chemotactic factor-like	9615		OMA, EggNOG
Horse	100033988	CXCL6	C-X-C motif chemokine ligand 6	9796		OMA, EggNOG
Cow	281735	CXCL5	chemokine (C-X-C motif) ligand 5	9913		OMA, EggNOG
Pig	396900	AMCF-II	alveolar macrophage-derived chemotactic factor-II	9823		OMA, EggNOG

PANTHER Classes
protein / signaling molecule / chemokine / C-X-C motif chemokine 5

DTO Classes
protein / Signaling / Chemokine / C-X-C motif chemokine 5

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.