This is a demo store. No orders will be fulfilled.

HTR5A

Description 5-hydroxytryptamine receptor 5A

Gene and Protein Information

Gene ID 3361
Uniprot Accession IDs P47898 Q2M2D2 5-HT-5
Ensembl ID ENSG00000157219
Symbol 5-HT5A
Chromosome 7
Family Belongs to the G-protein coupled receptor 1 family.
Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 463837 HTR5A 5-hydroxytryptamine receptor 5A 9598 VGNC:8691 OMA, EggNOG
Macaque 716134 HTR5A 5-hydroxytryptamine receptor 5A 9544 Inparanoid, OMA, EggNOG
Mouse 15563 Htr5a 5-hydroxytryptamine (serotonin) receptor 5A 10090 MGI:96283 Inparanoid, OMA, EggNOG
Rat 25689 Htr5a 5-hydroxytryptamine receptor 5A 10116 RGD:2851 Inparanoid, OMA, EggNOG
Dog 482814 HTR5A 5-hydroxytryptamine receptor 5A 9615 VGNC:41832 Inparanoid, OMA, EggNOG
Horse 100063709 HTR5A 5-hydroxytryptamine receptor 5A 9796 VGNC:18908 Inparanoid, OMA
Cow 541200 HTR5A 5-hydroxytryptamine receptor 5A 9913 VGNC:30001 Inparanoid, OMA
Pig 100154782 LOC100154782 5-hydroxytryptamine receptor 5B 9823 Inparanoid, EggNOG
Opossum HTR5A 5-hydroxytryptamine receptor 5A [Source:HGNC Symbol;Acc:HGNC:5300] 13616 OMA, EggNOG
Chicken 428409 HTR5A 5-hydroxytryptamine receptor 5A 9031 CGNC:53358 Inparanoid, OMA, EggNOG
Anole lizard 100556449 htr5a 5-hydroxytryptamine receptor 5A 28377 Inparanoid, OMA, EggNOG
Xenopus htr5a 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [Source:Xenbase;Acc:XB-GENE-981825] 8364 OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 5a
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT5 receptor    /    5-hydroxytryptamine receptor 5a

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.