JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

VEGFA

Description	Vascular endothelial growth factor A

Gene and Protein Information

Gene ID	7422
Uniprot Accession IDs	P15692 B5BU86 H0Y2S8 H0Y407 H0Y414 H0Y462 H0Y8N2 H3BLW7 O60720 O75875 Q074Z4 Q16889 Q5UB46 Q6P0P5 Q96KJ0 Q96L82 Q96NW5 Q9H1W8 Q9H1W9 Q9UH58 Q9UL23 VEGF-A
Ensembl ID	ENSG00000112715
Symbol	VEGF VPF VEGF MVCD1
Chromosome	6
Family	Belongs to the PDGF/VEGF growth factor family.
Sequence	MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	574209	VEGFA	vascular endothelial growth factor A	9544		Inparanoid, EggNOG
Mouse	22339	Vegfa	vascular endothelial growth factor A	10090	MGI:103178	Inparanoid, OMA, EggNOG
Rat	83785	Vegfa	vascular endothelial growth factor A	10116	RGD:619991	Inparanoid, OMA, EggNOG
Dog	403802	VEGFA	vascular endothelial growth factor A	9615	VGNC:48250	Inparanoid, OMA, EggNOG
Horse	100033839	VEGFA	vascular endothelial growth factor A	9796		Inparanoid, EggNOG
Cow	281572	VEGFA	vascular endothelial growth factor A	9913		Inparanoid, OMA, EggNOG
Pig	397157	VEGFA	vascular endothelial growth factor A	9823		Inparanoid, EggNOG
Opossum	100012132	VEGFA	vascular endothelial growth factor A	13616		OMA, EggNOG
Chicken	395909	VEGFA	vascular endothelial growth factor A	9031	CGNC:7830	Inparanoid, EggNOG
Anole lizard	100568086	vegfa	vascular endothelial growth factor A	28377		Inparanoid, EggNOG
Xenopus	100038089	vegfa	vascular endothelial growth factor A	8364	XB-GENE-485744	Inparanoid, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Vascular endothelial growth factor A

DTO Classes
protein / Signaling / Growth factor / Vascular endothelial growth factor A

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.