JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CA14

Description	Carbonic anhydrase 14

Gene and Protein Information

Gene ID	23632
Uniprot Accession IDs	Q9ULX7 Q5TB24 Q8NCF4
Ensembl ID	ENSG00000118298
Symbol	CAXiV
Chromosome	1
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469479	CA14	carbonic anhydrase 14	9598	VGNC:9849	OMA, EggNOG
Macaque	706360	CA14	carbonic anhydrase 14	9544		Inparanoid, OMA, EggNOG
Mouse	23831	Car14	carbonic anhydrase 14	10090	MGI:1344341	Inparanoid, OMA, EggNOG
Rat	791259	Car14	carbonic anhydrase 14	10116	RGD:1599277	Inparanoid, OMA, EggNOG
Dog	100855809	CA14	carbonic anhydrase 14	9615	VGNC:38609	Inparanoid, OMA, EggNOG
Horse	100054535	CA14	carbonic anhydrase 14	9796	VGNC:15962	Inparanoid, OMA, EggNOG
Cow	509027	CA14	carbonic anhydrase 14	9913	VGNC:26652	Inparanoid, OMA, EggNOG
Pig	100153371	CA14	carbonic anhydrase 14	9823		OMA, EggNOG
Opossum	100016752	CA14	carbonic anhydrase 14	13616		Inparanoid, OMA, EggNOG
Xenopus	100126213	ca14	carbonic anhydrase 14	8364	XB-GENE-855636	Inparanoid, OMA, EggNOG
Zebrafish	567897	ca14	carbonic anhydrase XIV	7955	ZDB-GENE-051030-57	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.