JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CA4

Description	Carbonic anhydrase 4

Gene and Protein Information

Gene ID	762
Uniprot Accession IDs	P22748 B4DQA4 Q6FHI7
Ensembl ID	ENSG00000167434
Symbol	CAIV Car4 RP17
Chromosome	17
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454807	CA4	carbonic anhydrase 4	9598	VGNC:9136	OMA, EggNOG
Mouse	12351	Car4	carbonic anhydrase 4	10090	MGI:1096574	Inparanoid, OMA, EggNOG
Rat	29242	Car4	carbonic anhydrase 4	10116	RGD:2242	OMA, EggNOG
Dog	480591	CA4	carbonic anhydrase 4	9615	VGNC:38612	Inparanoid, OMA, EggNOG
Horse	100071384	CA4	carbonic anhydrase 4	9796	VGNC:15965	Inparanoid, OMA, EggNOG
Cow	280741	CA4	carbonic anhydrase 4	9913	VGNC:26654	Inparanoid, OMA, EggNOG
Pig	100511956	CA4	carbonic anhydrase 4	9823		Inparanoid, OMA, EggNOG
Chicken	417647	CA4	carbonic anhydrase 4	9031	CGNC:3991	Inparanoid, OMA, EggNOG
Anole lizard	103280438	ca4	carbonic anhydrase 4	28377		Inparanoid, OMA, EggNOG
Xenopus	100489625	ca4	carbonic anhydrase IV	8364	XB-GENE-5952677	OMA, EggNOG
Zebrafish	555196	ca4a	carbonic anhydrase IV a	7955	ZDB-GENE-080204-85	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.