JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CA1

Description	Carbonic anhydrase 1

Gene and Protein Information

Gene ID	759
Uniprot Accession IDs	P00915
Ensembl ID	ENSG00000133742
Symbol	CAB CA-I Car1 HEL-S-11
Chromosome	8
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464264	CA1	carbonic anhydrase 1	9598	VGNC:10213	Inparanoid, OMA
Macaque	703701	CA1	carbonic anhydrase 1	9544		Inparanoid, OMA
Mouse	12346	Car1	carbonic anhydrase 1	10090	MGI:88268	Inparanoid, OMA
Rat	310218	Car1	carbonic anhydrase I	10116	RGD:1309780	Inparanoid, OMA
Dog	487031	CA1	carbonic anhydrase 1	9615	VGNC:38604	Inparanoid, OMA
Cow	510801	CA1	carbonic anhydrase I	9913		Inparanoid, OMA
Opossum	497246	CA1	carbonic anhydrase 1	13616		Inparanoid, OMA
Xenopus	100496485	ca1	carbonic anhydrase I	8364	XB-GENE-957160	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.