JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CA5B

Description	Carbonic anhydrase 5B, mitochondrial

Gene and Protein Information

Gene ID	11238
Uniprot Accession IDs	Q9Y2D0 A8K4T5
Ensembl ID	ENSG00000169239
Symbol	CAVB CA-VB
Chromosome	X
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	713128	CA5B	carbonic anhydrase 5B	9544		Inparanoid, OMA, EggNOG
Mouse	56078	Car5b	carbonic anhydrase 5b, mitochondrial	10090	MGI:1926249	Inparanoid, OMA, EggNOG
Rat	302669	Car5b	carbonic anhydrase 5B	10116	RGD:1549783	Inparanoid, OMA, EggNOG
Dog	100856271	CA5B	carbonic anhydrase 5B	9615	VGNC:38613	Inparanoid, OMA, EggNOG
Horse	100051095	LOC100051095	carbonic anhydrase 5B, mitochondrial	9796		OMA, EggNOG
Cow	514494	CA5B	carbonic anhydrase 5B	9913	VGNC:26655	Inparanoid, OMA, EggNOG
Pig	100156418	CA5B	carbonic anhydrase 5B	9823		OMA, EggNOG
Opossum	100031763	CA5B	carbonic anhydrase 5B	13616		Inparanoid, OMA, EggNOG
Platypus		CA5B	carbonic anhydrase 5B [Source:HGNC Symbol;Acc:HGNC:1378]	9258		OMA, EggNOG
Xenopus	733981	ca5b	carbonic anhydrase VB, mitochondrial	8364	XB-GENE-1003819	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.