The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PDCL3
| Description |
Phosducin-like protein 3
|
Gene and Protein Information
| Gene ID |
79031
|
| Uniprot Accession IDs |
Q9H2J4
B2RA00
Q53S68
|
| Ensembl ID |
ENSG00000115539
|
| Symbol |
PhLP2A
VIAF1
VIAF
PHLP3
VIAF1
HTPHLP
PHLP2A
|
| Chromosome |
2
|
| Family |
Belongs to the phosducin family. |
| Sequence |
MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Mouse |
68833 |
Pdcl3 |
phosducin-like 3 |
10090 |
MGI:1916083 |
Inparanoid, OMA, EggNOG |
| Rat |
316348 |
Pdcl3 |
phosducin-like 3 |
10116 |
RGD:1309663 |
Inparanoid, OMA, EggNOG |
| Dog |
474553 |
PDCL3 |
phosducin like 3 |
9615 |
VGNC:44344 |
Inparanoid, OMA, EggNOG |
| Horse |
100059384 |
PDCL3 |
phosducin like 3 |
9796 |
VGNC:21236 |
Inparanoid, OMA, EggNOG |
| Cow |
514033 |
PDCL3 |
phosducin like 3 |
9913 |
VGNC:32667 |
Inparanoid, OMA, EggNOG |
| Opossum |
100015433 |
PDCL3 |
phosducin like 3 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Platypus |
|
PDCL3 |
phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860] |
9258 |
|
OMA, EggNOG |
| Chicken |
418709 |
PDCL3 |
phosducin like 3 |
9031 |
CGNC:12579 |
Inparanoid, OMA, EggNOG |
| Anole lizard |
100562180 |
pdcl3 |
phosducin like 3 |
28377 |
|
Inparanoid, OMA, EggNOG |
| Xenopus |
496850 |
pdcl3 |
phosducin like 3 |
8364 |
XB-GENE-5737550 |
Inparanoid, OMA, EggNOG |
| Fruitfly |
39364 |
viaf |
viral IAP-associated factor |
7227 |
FBgn0036237 |
OMA, EggNOG |
| S.cerevisiae |
854456 |
PLP2 |
Plp2p |
4932 |
S000005807 |
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.