This is a demo store. No orders will be fulfilled.

Recombinant Rat IFN-gamma Protein

  • Accession #: P01581
  • Bioactivity: Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp186511
Grouped product items
SKU Size
Availability
Price Qty
rp186511-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$39.90
rp186511-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$99.90
rp186511-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$139.90
rp186511-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$939.90

Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 23-156 aa

Basic Description

Product Name Recombinant Rat IFN-gamma Protein
Synonyms IFG | IFI | IFNG | IFNgamma | IFN-gamma | Immune interferon | interferon gamma | interferon, gamma
Grade ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymp
Bioactivity Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.
Endotoxin Concentration <1.0 EU/μg
Amino Acids 23-156 aa
Sequence QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC​
Accession # P01581
Predicted molecular weight 29.2 kDa
SDS-PAGE 12.5 kDa, under reducing conditions; 12.7 & 26.8 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Concentration See COA
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

Recombinant Rat IFN-gamma Protein (rp186511) - Protein Bioactivity

Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.

Recombinant Rat IFN-gamma Protein (rp186511) - SDS-PAGE
3 μg/lane of Recombinant Rat IFN-gamma Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.5 kDa under reducing conditions and 12.7 & 26.8 kDa under non-reducing conditions.
IFNγ has a characteristic domain-swapped dimer structure with two of the six α-helices exchanged with each other. (PMID: 38879015)

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.