Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp186511-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$39.90
|
|
|
rp186511-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$99.90
|
|
|
rp186511-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$139.90
|
|
|
rp186511-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$939.90
|
|
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 23-156 aa
| Product Name | Recombinant Rat IFN-gamma Protein |
|---|---|
| Synonyms | IFG | IFI | IFNG | IFNgamma | IFN-gamma | Immune interferon | interferon gamma | interferon, gamma |
| Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
| Specifications & Purity | Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA |
| Biochemical and Physiological Mechanisms | IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymp |
| Bioactivity | Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 23-156 aa |
| Sequence | QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
| Accession # | P01581 |
| Predicted molecular weight | 29.2 kDa |
| SDS-PAGE | 12.5 kDa, under reducing conditions; 12.7 & 26.8 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Concentration | See COA |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Recombinant Rat IFN-gamma Protein (rp186511) - Protein Bioactivity
Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.
Recombinant Rat IFN-gamma Protein (rp186511) - SDS-PAGE
3 μg/lane of Recombinant Rat IFN-gamma Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.5 kDa under reducing conditions and 12.7 & 26.8 kDa under non-reducing conditions.
IFNγ has a characteristic domain-swapped dimer structure with two of the six α-helices exchanged with each other. (PMID: 38879015)