This is a demo store. No orders will be fulfilled.

Recombinant Mouse IL-1 beta Protein, >95%(SDS-PAGE), high purity

  • Expression System: E. coli
  • Accession #: P10749
  • Protein Tag: C-His
  • Bioactivity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells.The ED₅₀ for this effect is typically 10-50 pg/mL.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp154118
Grouped product items
SKU Size
Availability
Price Qty
rp154118-10μg
10μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$139.90
rp154118-50μg
50μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$479.90
rp154118-100μg
100μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$769.90
rp154118-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,329.90

Animal Free, >95%(SDS-PAGE), Active, E.coli, His tag, 118-269 aa

Basic Description

Product Name Recombinant Mouse IL-1 beta Protein, >95%(SDS-PAGE), high purity
Synonyms Catabolin | H1 | IFN beta inducing factor | IL 1 | IL 1 beta | IL-1 beta | IL1 | IL1 BETA | IL1B | Il-1b | IL1B_HUMAN | IL1F2 | Interleukin 1 beta | Interleukin 1 beta precursor | interleukin 1, beta | Interleukin-1 beta | OAF | Osteoclast activating fact
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description

Background:

IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2), which are the products of distinct genes. IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 17% amino acid (aa) identity in mouse. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. IL-1 RII has high affinity for IL-1 beta but functions as a decoy receptor and negative regulator of IL-1 beta activity. IL-1ra functions as a competitive antagonist by preventing IL-1 alpha and IL-1 beta from interacting with IL-1 RI. The mouse IL-1 beta cDNA encodes a 269 aa precursor. A 117 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature mouse IL-1 beta shares 90% aa sequence identity with cotton rat and rat and 65%-78% identity with canine, equine, feline, human, porcine, and rhesus IL-1 beta.


Post-translational modifications:

Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.


Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity >95%(SDS-PAGE)
Bioactivity Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells.The ED₅₀ for this effect is typically 10-50 pg/mL.
Endotoxin Concentration <1.0 EU/μg
Expression System E. coli
Species Mouse
Amino Acids 118-269 aa
Sequence MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSSHHHHHH
Protein Tag C-His
N-terminal Sequence Met
Protein Length Full length protein
Conjugation Unconjugated
Accession # P10749
Source Recombinant
Predicted molecular weight 18 kDa
SDS-PAGE 16.1 kDa, under reducing conditions; 16.1 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Shape Lyophilized
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration of 0.1-1mg/mL.Dissolve the lyophilized protein in distilled water.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles

Images

Recombinant Mouse IL-1 beta Protein (rp154118)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-1 beta was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.1 kDa.

Recombinant Mouse IL-1 beta Protein (rp154118) - Protein Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is typically 10 - 50 pg/mL.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number Certificate Type Date Item
ZJ23F0500160 Certificate of Analysis May 22, 2023 rp154118
ZJ23F0500161 Certificate of Analysis May 22, 2023 rp154118
ZJ23F0500163 Certificate of Analysis May 22, 2023 rp154118

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.