Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp154118-10μg
|
10μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$139.90
|
|
|
rp154118-50μg
|
50μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$479.90
|
|
|
rp154118-100μg
|
100μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$769.90
|
|
|
rp154118-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$3,329.90
|
|
Animal Free, >95%(SDS-PAGE), Active, E.coli, His tag, 118-269 aa
| Product Name | Recombinant Mouse IL-1 beta Protein, >95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | Catabolin | H1 | IFN beta inducing factor | IL 1 | IL 1 beta | IL-1 beta | IL1 | IL1 BETA | IL1B | Il-1b | IL1B_HUMAN | IL1F2 | Interleukin 1 beta | Interleukin 1 beta precursor | interleukin 1, beta | Interleukin-1 beta | OAF | Osteoclast activating fact |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description |
Background: IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2), which are the products of distinct genes. IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 17% amino acid (aa) identity in mouse. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. IL-1 RII has high affinity for IL-1 beta but functions as a decoy receptor and negative regulator of IL-1 beta activity. IL-1ra functions as a competitive antagonist by preventing IL-1 alpha and IL-1 beta from interacting with IL-1 RI. The mouse IL-1 beta cDNA encodes a 269 aa precursor. A 117 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature mouse IL-1 beta shares 90% aa sequence identity with cotton rat and rat and 65%-78% identity with canine, equine, feline, human, porcine, and rhesus IL-1 beta. Post-translational modifications: Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | >95%(SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells.The ED₅₀ for this effect is typically 10-50 pg/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Species | Mouse |
| Amino Acids | 118-269 aa |
| Sequence | MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSSHHHHHH |
| Protein Tag | C-His |
| N-terminal Sequence | Met |
| Protein Length | Full length protein |
| Conjugation | Unconjugated |
| Accession # | P10749 |
| Source | Recombinant |
| Predicted molecular weight | 18 kDa |
| SDS-PAGE | 16.1 kDa, under reducing conditions; 16.1 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Shape | Lyophilized |
|---|---|
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration of 0.1-1mg/mL.Dissolve the lyophilized protein in distilled water.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles |
Recombinant Mouse IL-1 beta Protein (rp154118)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-1 beta was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.1 kDa.
Recombinant Mouse IL-1 beta Protein (rp154118) - Protein Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is typically 10 - 50 pg/mL.
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
| Certificate of Analysis | May 22, 2023 | rp154118 | |
| Certificate of Analysis | May 22, 2023 | rp154118 | |
| Certificate of Analysis | May 22, 2023 | rp154118 |