Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp167869-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$89.90
|
|
|
rp167869-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$269.90
|
|
|
rp167869-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$499.90
|
|
|
rp167869-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 22-182 aa
| Product Name | Recombinant Mouse IFN-beta Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | beta-interferon | Fibroblast interferon | IFB | IFF | IFN beta | IFN-beta | IFNB | IFNB 1 | IFNB_HUMAN | IFNB1 | Interferon beta | Interferon beta 1 fibroblast | Interferon beta precursor | MGC96956 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Recombinant Mouse IFN-beta enhances STAT1 autophosphorylation in Bone-marrow-derived macrophage (BMDM). 5-500 ng/mL of Recombinant Mouse IFN-beta can enhance STAT1 autophosphorylation. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 22-182 aa |
| Sequence | INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQNHHHHHH |
| Protein Tag | C-His |
| Accession # | P01575 |
| Predicted molecular weight | 21 kDa |
| SDS-PAGE | 30 - 38 kDa, under reducing conditions; 30 - 38 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Shape | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Mouse IFN-beta Protein (rp167869) - SDS-PAGE
3 μg/lane of Recombinant Mouse IFN-beta Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 38 kDa.