This is a demo store. No orders will be fulfilled.

Recombinant Mouse IFN-beta Protein, ≥95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: P01575
  • Protein Tag: C-His
  • Bioactivity: Recombinant Mouse IFN-beta enhances STAT1 autophosphorylation in Bone-marrow-derived macrophage (BMDM). 5-500 ng/mL of Recombinant Mouse IFN-beta can enhance STAT1 autophosphorylation.
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp167869
Grouped product items
SKU Size
Availability
Price Qty
rp167869-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
rp167869-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$269.90
rp167869-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$499.90
rp167869-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 22-182 aa

Basic Description

Product Name Recombinant Mouse IFN-beta Protein, ≥95% (SDS-PAGE), high purity
Synonyms beta-interferon | Fibroblast interferon | IFB | IFF | IFN beta | IFN-beta | IFNB | IFNB 1 | IFNB_HUMAN | IFNB1 | Interferon beta | Interferon beta 1 fibroblast | Interferon beta precursor | MGC96956
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Has antiviral, antibacterial and anticancer activities.

Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity ≥95% (SDS-PAGE)
Bioactivity Recombinant Mouse IFN-beta enhances STAT1 autophosphorylation in Bone-marrow-derived macrophage (BMDM). 5-500 ng/mL of Recombinant Mouse IFN-beta can enhance STAT1 autophosphorylation.
Endotoxin Concentration <0.1 EU/μg
Expression System HEK293
Amino Acids 22-182 aa
Sequence INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQNHHHHHH
Protein Tag C-His
Accession # P01575
Predicted molecular weight 21 kDa
SDS-PAGE 30 - 38 kDa, under reducing conditions; 30 - 38 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Mouse IFN-beta Protein (rp167869) - SDS-PAGE
3 μg/lane of Recombinant Mouse IFN-beta Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 38 kDa.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.