Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp181569-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$139.90
|
|
|
rp181569-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$399.90
|
|
|
rp181569-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$629.90
|
|
|
rp181569-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$3,329.90
|
|
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 31-208 aa
| Product Name | Recombinant Mouse G-CSF Protein |
|---|---|
| Synonyms | C17orf33 | chromosome 17 open reading frame 33 | colony stimulating factor 3 (granulocyte) | CSF3 | CSF3OS | Filgrastim | GCSF | G-CSF | GCSFlenograstim | granulocyte colony-stimulating factor | Lenograstim | MGC45931 | Pluripoietin |
| Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
| Specifications & Purity | Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA |
| Biochemical and Physiological Mechanisms | G-CSF is a pleiotropic cytokine best known for its specific effects on the proliferation, differentiation, and activation of hematopoietic cells of the neutrophilic granulocyte lineage. It is produced mainly by monocytes and macrophages upon activation by |
| Bioactivity | Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 16.5 pg/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 31-208 aa |
| Sequence | VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
| Accession # | P09920 |
| Predicted molecular weight | 18.9 kDa |
| SDS-PAGE | 18.1 kDa, under reducing conditions; 16.9 & 19.0 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Concentration | See COA |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Recombinant Mouse G-CSF Protein (rp181569) - Protein Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically 16.5 pg/mL
Recombinant Mouse G-CSF Protein (rp181569) - SDS-PAGE
3 μg/lane of Recombinant Mouse G-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.1 kDa under reducing conditions and 16.9 & 19.0 kDa under non-reducing conditions.
Starting at $239.90