This is a demo store. No orders will be fulfilled.

Recombinant Mouse G-CSF Protein

  • Accession #: P09920
  • Bioactivity: Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 16.5 pg/mL.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp181569
Grouped product items
SKU Size
Availability
Price Qty
rp181569-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$139.90
rp181569-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
rp181569-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$629.90
rp181569-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,329.90

Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 31-208 aa

Basic Description

Product Name Recombinant Mouse G-CSF Protein
Synonyms C17orf33 | chromosome 17 open reading frame 33 | colony stimulating factor 3 (granulocyte) | CSF3 | CSF3OS | Filgrastim | GCSF | G-CSF | GCSFlenograstim | granulocyte colony-stimulating factor | Lenograstim | MGC45931 | Pluripoietin
Grade ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms G-CSF is a pleiotropic cytokine best known for its specific effects on the proliferation, differentiation, and activation of hematopoietic cells of the neutrophilic granulocyte lineage. It is produced mainly by monocytes and macrophages upon activation by
Bioactivity Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 16.5 pg/mL.
Endotoxin Concentration <1.0 EU/μg
Amino Acids 31-208 aa
Sequence VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Accession # P09920
Predicted molecular weight 18.9 kDa
SDS-PAGE 18.1 kDa, under reducing conditions; 16.9 & 19.0 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Concentration See COA
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

Recombinant Mouse G-CSF Protein (rp181569) - Protein Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically 16.5 pg/mL

Recombinant Mouse G-CSF Protein (rp181569) - SDS-PAGE
3 μg/lane of Recombinant Mouse G-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.1 kDa under reducing conditions and 16.9 & 19.0 kDa under non-reducing conditions.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.