Skip to the beginning of the images gallery

Recombinant Human Proteasome subunit beta type 2/PSMB2 Protein

COA

Grade & Purity:

Carrier Free

≥90%(SDS-PAGE)
See COA

Accession #: P49721
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp189463

Grouped product items
SKU	Size	Availability	Price
rp189463-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp189463-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$399.90
rp189463-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$629.90
rp189463-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,899.90

Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His, 2-201 aa

View related series

Click to view protein information: PSMB2

Accession#: P49721 (1) Gene ID: 5690 (1) Proteasome subunit beta type 2/PSMB2 (1) PSMB2 (1)

Basic Description

Product Name	Recombinant Human Proteasome subunit beta type 2/PSMB2 Protein
Synonyms	HC7 I \| Macropain subunit C7 I \| Macropain subunit C7-I \| Multicatalytic endopeptidase complex subunit C7 1 \| Multicatalytic endopeptidase complex subunit C7 I \| Multicatalytic endopeptidase complex subunit C7-I \| Proteasome (prosome, macropain) subunit b
Grade	Carrier Free
Specifications & Purity	Carrier Free, ≥90%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms	Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated w
Endotoxin Concentration	<1.0 EU/μg
Amino Acids	2-201 aa
Sequence	MHHHHHHEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Accession #	P49721
Predicted molecular weight	23.7 kDa
SDS-PAGE	21.5 kDa, under reducing conditions; 20.7 & 38.3 & 40.3 kDa, under non-reducing conditions.
Molecule Type	Protein

Storage and Shipping

Concentration	See COA
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20℃ for 6 months.Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human Proteasome subunit beta type 2/PSMB2 Protein (rp189463)

Recombinant Human Proteasome subunit beta type 2/PSMB2 Protein (rp189463) - SDS-PAGE
2 μg/lane of Recombinant Human Proteasome subunit beta type 2/PSMB2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 21.5 kDa under reducing conditions and 20.7 & 38.3 & 40.3 kDa under non-reducing conditions.
The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7 (PMID：25599644).

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration