Skip to the beginning of the images gallery

Recombinant Human IL-28B/IFN-lambda 3 Protein, >95% (SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: Q8IZI9
Protein Tag: C-His
Bioactivity: Testing in progress
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp169633

Grouped product items
SKU	Size	Availability	Price
rp169633-10μg	10μg	≥10	$139.90
rp169633-50μg	50μg	2	$399.90
rp169633-100μg	100μg	1	$599.90
rp169633-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,299.90

Animal Free, >95% (SDS-PAGE), 293F cell, C-His tag, 1-196 aa

View related series

Click to view protein information: IFNL3

Accession#: Q8IZI9 (1) Gene ID: 282617 (1) IFNL3 (1) IL-28B/IFN-lambda 3 (1)

Basic Description

Product Name	Recombinant Human IL-28B/IFN-lambda 3 Protein, >95% (SDS-PAGE), high purity
Synonyms	Cytokine Zcyto22 \| IFN-lambda-3 \| IFN-lambda-4 \| IL-28B \| IL-28C \| IL28B \| IL28B_HUMAN \| IL28C \| Interferon lambda-3 \| Interferon lambda-4 \| interleukin 28B (interferon, lambda 3) \| Interleukin 28C \| Interleukin-28B \| Interleukin-28C \| IFN-lambda 3
Grade	Animal Free, Azide Free, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： IL-28B (also named interferon-lambda 3, IFN-lambda 3), IL-28A (IFN-lambda 2) and IL-29 (IFN-lambda 1) are type III interferons that are class II cytokine receptor ligands. They are distantly related to members of the IL-10 family and type I IFN family. Human IL-28B cDNA encodes a 200 amino acid (aa) protein with a 25 aa signal peptide and a 175 aa mature protein that lacks N-glycosylation sites. Mature human IL-28B shares 64% and 75% aa sequence identity with mouse and canine IL-28B, respectively, and is active across species. Human IL-28B shares 94% and 69% aa identity with human IL-28A and IL‑29, respectively. Type III interferons are widely expressed, but are mainly produced by antigen presenting cells in response to viruses and double-stranded RNA that interact with Toll-like receptors or RIG-1 family helicases. They signal through a widely expressed receptor that is a heterodimer of the IL-10 receptor beta (IL-10 R beta ) and IL-28 receptor alpha (IL-28 R alpha ; also called IFN-lambda R1). Interaction of either type I or type III IFNs with their receptors activates similar pathways, including JAK tyrosine kinase activation, STAT phosphorylation and formation of the IFN-stimulated regulatory factor 3 (ISGF-3) transcription factor complex. Both type I and III IFNs induce anti‑viral activity and up‑regulate MHC class I antigen expression. Cell lines responsive to type III IFNs are also responsive to type I IFNs, but in general, higher concentrations of type III IFNs are needed for similar in vitro responses. In vivo, however, type III IFNs enhance levels of IFN-gamma in serum, suggesting that the robust anti-viral activity of type III IFNs may stem in part from activation of the immune system. Anti-proliferative and antitumor activity in vivo has also been shown for type III IFNs.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Bioactivity	Testing in progress
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-196 aa
Sequence	MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH
Protein Tag	C-His
Accession #	Q8IZI9
Predicted molecular weight	20.5 kDa
SDS-PAGE	18.4-24.1 kDa, under reducing conditions
Molecule Type	Protein

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human IL-28B/IFN-lambda 3 Protein (rp169633)

Recombinant Human IL-28B/IFN-lambda 3 Protein (rp169633) - SDS-PAGE
3 μg/lane of Recombinant Human IL-28B/IFN-lambda 3 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 18.4-24.1 kDa under reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0303495	Certificate of Analysis	Mar 22, 2024	rp169633
ZJ24F0303496	Certificate of Analysis	Mar 22, 2024	rp169633
ZJ24F0303497	Certificate of Analysis	Mar 22, 2024	rp169633
ZJ24R0300331	Certificate of Analysis	Mar 15, 2024	rp169633

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration