Skip to the beginning of the images gallery

Recombinant Human GM-CSF Protein

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: E. coli
Accession #: P04141
Protein Tag: N-His
Bioactivity: Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.82 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp156011

Grouped product items
SKU	Size	Availability	Price
rp156011-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$99.90
rp156011-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$299.90
rp156011-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$459.90
rp156011-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,399.90

Carrier Free, ≥95% (SDS-PAGE), Active, E.coli, N-His tag, 18-144 aa

View related series

Click to view protein information: CSF2

Accession#:P04141 (10) CSF2 (14) Gene ID:1437 (10) GM-CSF (14)

Basic Description

Product Name	Recombinant Human GM-CSF Protein
Synonyms	Molgramostim \| molgramostin \| Sargramostim \| colony stimulating factor 2 (granulocyte-macrophage) \| Colony-stimulating factor \| CSF \| CSF2 \| CSF-2 \| GMCSF \| GM-CSF \| GMCSFgranulocyte-macrophage colony-stimulating factor \| granulocyte-macrophage colony sti
Grade	Bioactive, Carrier Free, High Performance
Product Description	Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： GM CSF was initially characterized as a factor that can support the in vitro colony formation of granulocyte macrophage progenitors. It is also a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. GM CSF is produced by a number of different cell types (including T cells, B cells, macrophages, mast cells, endothelial cells, fibroblasts, and adipocytes) in response to cytokine or inflammatory stimuli. On mature hematopoietic cells, GM CSF is a survival factor for and activates the effector functions of granulocytes, monocytes/macrophages, and eosinophils. GM CSF promotes a Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity. It shows clinical effectiveness in ameliorating chemotherapy induced neutropenia, and GM CSF transfected tumor cells are utilized as cancer vaccines. The 22 kDa glycosylated GM CSF, similar to IL 3 and IL 5, is a cytokine with a core of four bundled alpha -helices. Mature human GM CSF shares 63% 70% amino acid sequence identity with canine, feline, porcine, and rat GM CSF and 54% with mouse GM CSF. GM CSF exerts its biological effects through a heterodimeric receptor complex composed of GM CSF R alpha /CD116 and the signal transducing common beta chain (CD131) which is also a component of the high affinity receptors for IL 3 and IL 5. In addition, GM CSF binds a naturally occurring soluble form of GM CSF R alpha. Human GM CSF is active on canine and feline cells but not on murine cells.
Specifications & Purity	Carrier Free, High performance, Bioactive, ≥95%(SDS-PAGE)
Bioactivity	Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.82 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	18-144 aa
Sequence	MGSSHHHHHHSSGLVPRGSHMAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Protein Tag	N-His
Accession #	P04141
Predicted molecular weight	16.8 kDa
SDS-PAGE	14.8 kDa, under reducing conditions; 14.8 kDa, under non-reducing condition

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - Protein Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is typically 0.82 ng/mL.

SDS-PAGE: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - SDS-PAGE
3 μg/lane of Recombinant Human GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.8 kDa.

ELISA: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - ELISA
Immobilized Recombinant Human GM-CSF Protein (rp156011) at 1.0 μg/mL can bind Namilumab (anti-GM-CSF) (Ab175608) with the EC50 of 62.67 ng/mL.

ELISA: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - ELISA
Immobilized Recombinant Human GM-CSF Protein (rp156011) at 1.0 μg/mL can bind Gimsilumab (anti-GM-CSF) (Ab175548) with the EC50 of 23.52 ng/mL.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration