This is a demo store. No orders will be fulfilled.

Recombinant Human FGF basic/FGF2/bFGF GMP Protein

  • Expression System: E. coli
  • Accession #: P09038-4
  • Protein Tag: No tag
  • Bioactivity: Measured in a cell proliferation assay using NR6R‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.100-1.00 ng/mL. The specific activity of Recombinant Human FGF basic/FGF2 GMP is >8.0 x 10^5 IU/mg, which is calibrated against the human FGF basic/FGF2 WHO International Standard (NIBSC code: 90/712).
  • Endotoxin Concentration: <0.01 EU/μg
In stock
Item Number
rp166699-GMP
Grouped product items
SKU Size
Availability
Price Qty
rp166699-GMP-25μg
25μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$289.90
rp166699-GMP-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,769.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 135-288 aa

Basic Description

Product Name Recombinant Human FGF basic/FGF2/bFGF GMP Protein
Synonyms Fibroblast Growth Factor basic | basic fibroblast growth factor bFGF | Basic fibroblast growth factor | bFGF | FGF basic | FGF2 | FGF-2 | FGFB | prostatropin | fibroblast growth factor 2 (basic) | HBGF-2 | heparin-binding growth factor 2
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and ce
Bioactivity Measured in a cell proliferation assay using NR6R‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.100-1.00 ng/mL. The specific activity of Recombinant Human FGF basic/FGF2 GMP is >8.0 x 10^5 IU/mg, which is calibrated against the human FGF basic/FGF2 WHO International Standard (NIBSC code: 90/712).
Endotoxin Concentration <0.01 EU/μg
Expression System E. coli
Amino Acids 135-288 aa
Sequence AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Protein Tag No tag
N-terminal Sequence Ala135-Ala-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala Ala136-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala-Leu
Accession # P09038-4
Predicted molecular weight 17 kDa
SDS-PAGE 18 kDa under reducing conditions.
Molecule Type Protein

Storage and Shipping

Reconstitution Reconstitute 25 μg size at 250 μg/mL and all other sizes at 500 μg/mL in sterile water.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.