Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp166699-GMP-25μg
|
25μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$289.90
|
|
|
rp166699-GMP-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$3,769.90
|
|
GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 135-288 aa
| Product Name | Recombinant Human FGF basic/FGF2/bFGF GMP Protein |
|---|---|
| Synonyms | Fibroblast Growth Factor basic | basic fibroblast growth factor bFGF | Basic fibroblast growth factor | bFGF | FGF basic | FGF2 | FGF-2 | FGFB | prostatropin | fibroblast growth factor 2 (basic) | HBGF-2 | heparin-binding growth factor 2 |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance |
| Specifications & Purity | Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE&SEC-HPLC) |
| Biochemical and Physiological Mechanisms | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and ce |
| Bioactivity | Measured in a cell proliferation assay using NR6R‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.100-1.00 ng/mL. The specific activity of Recombinant Human FGF basic/FGF2 GMP is >8.0 x 10^5 IU/mg, which is calibrated against the human FGF basic/FGF2 WHO International Standard (NIBSC code: 90/712). |
| Endotoxin Concentration | <0.01 EU/μg |
| Expression System | E. coli |
| Amino Acids | 135-288 aa |
| Sequence | AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein Tag | No tag |
| N-terminal Sequence | Ala135-Ala-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala Ala136-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala-Leu |
| Accession # | P09038-4 |
| Predicted molecular weight | 17 kDa |
| SDS-PAGE | 18 kDa under reducing conditions. |
| Molecule Type | Protein |
| Reconstitution | Reconstitute 25 μg size at 250 μg/mL and all other sizes at 500 μg/mL in sterile water. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl |