Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp183675-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$79.90
|
|
|
rp183675-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$239.90
|
|
|
rp183675-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$389.90
|
|
|
rp183675-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His-Sumo tag, 2-133 aa
| Product Name | Recombinant Human FABP3/H-FABP Protein |
|---|---|
| Synonyms | FABP11 | FABP3 | fatty acid binding protein 11 | fatty acid binding protein 3, muscle and heart (mammary-derived growthinhibitor) | Fatty acid-binding protein 3 | Fatty acid-binding protein 3, muscle | fatty acid-binding protein, heart | Heart-type fatty |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Fatty acid binding protein 3 (FABP3, also termed heart-type fatty acid binding protein) is a member of the intracellular lipid-binding protein family that may be essential in fatty acid transport, cell growth, cellular signaling and gene transcription. Pr |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-133 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
| Protein Tag | N-His & SUMO |
| Accession # | P05413 |
| Predicted molecular weight | 28.4 kDa |
| SDS-PAGE | 29.8 kDa, under reducing conditions; 29.8 kDa, under non-reducing conditions |
| Molecule Type | Protein |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 2.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Recombinant Human FABP3/H-FABP Protein (rp183675) - SDS-PAGE
3 μg/lane of Recombinant Human FABP3/H-FABP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.8 kDa.