This is a demo store. No orders will be fulfilled.

Recombinant Human FABP3/H-FABP Protein

  • Expression System: E. coli
  • Accession #: P05413
  • Protein Tag: N-His & SUMO
  • Bioactivity: Testing in progress
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp183675
Grouped product items
SKU Size
Availability
Price Qty
rp183675-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$79.90
rp183675-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$239.90
rp183675-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$389.90
rp183675-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His-Sumo tag, 2-133 aa

Basic Description

Product Name Recombinant Human FABP3/H-FABP Protein
Synonyms FABP11 | FABP3 | fatty acid binding protein 11 | fatty acid binding protein 3, muscle and heart (mammary-derived growthinhibitor) | Fatty acid-binding protein 3 | Fatty acid-binding protein 3, muscle | fatty acid-binding protein, heart | Heart-type fatty
Grade Carrier Free
Specifications & Purity Carrier Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms Fatty acid binding protein 3 (FABP3, also termed heart-type fatty acid binding protein) is a member of the intracellular lipid-binding protein family that may be essential in fatty acid transport, cell growth, cellular signaling and gene transcription. Pr
Bioactivity Testing in progress
Endotoxin Concentration <1.0 EU/μg
Expression System E. coli
Amino Acids 2-133 aa
Sequence MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA​
Protein Tag N-His & SUMO
Accession # P05413
Predicted molecular weight 28.4 kDa
SDS-PAGE 29.8 kDa, under reducing conditions; 29.8 kDa, under non-reducing conditions
Molecule Type Protein

Storage and Shipping

Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 2.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Recombinant Human FABP3/H-FABP Protein (rp183675) - SDS-PAGE
3 μg/lane of Recombinant Human FABP3/H-FABP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.8 kDa.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.