This is a demo store. No orders will be fulfilled.

Recombinant Human CXCR4 Protein

  • Accession #: P61073
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp220577
Grouped product items
SKU Size
Availability
Price Qty
rp220577-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
rp220577-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$269.90
rp220577-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$429.90
rp220577-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90

Carrier Free, ≥85% (SDS-PAGE), E. coli, No tag, 2-38 aa

Basic Description

Product Name Recombinant Human CXCR4 Protein
Grade Carrier Free
Specifications & Purity Carrier Free, ≥85%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ions levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhance intracellular calcium ions and
Endotoxin Concentration <1.0 EU/μg
Amino Acids 2-38 aa
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGENLYFQGMEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK
Accession # P61073
Predicted molecular weight 32.5 kDa
SDS-PAGE 30.9 kDa, under reducing conditions; 28.9 & 30.9 & 31.8 kDa, under non-reducing conditions.
Molecule Type Protein

Storage and Shipping

Concentration See COA
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Human CXCR4 Protein (rp214408) - SDS-PAGE
3 μg/lane of Recombinant Human CXCR4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 30.9 kDa under reducing conditions and 28.9 & 30.9 & 31.8 kDa under non-reducing conditions.
The CXCR4 protein exhibits multiple bands under both reducing (R) and non-reducing (NR) conditions. In R conditions, the band multiplicity likely stems from limited post-translational modification (PTM) variability (e.g., partial glycosylation or sulfation). Under NR conditions, the additional bands may arise from conformational heterogeneity, such as disulfide bond-mediated structural variations or oligomerization states stabilized in the absence of reducing agents (PubMed:10089882, 10756055).

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.