Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp220577-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$89.90
|
|
|
rp220577-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$269.90
|
|
|
rp220577-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$429.90
|
|
|
rp220577-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Carrier Free, ≥85% (SDS-PAGE), E. coli, No tag, 2-38 aa
| Product Name | Recombinant Human CXCR4 Protein |
|---|---|
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥85%(SDS-PAGE), See COA |
| Biochemical and Physiological Mechanisms | Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ions levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhance intracellular calcium ions and |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 2-38 aa |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGENLYFQGMEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK |
| Accession # | P61073 |
| Predicted molecular weight | 32.5 kDa |
| SDS-PAGE | 30.9 kDa, under reducing conditions; 28.9 & 30.9 & 31.8 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Concentration | See COA |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Human CXCR4 Protein (rp214408) - SDS-PAGE
3 μg/lane of Recombinant Human CXCR4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 30.9 kDa under reducing conditions and 28.9 & 30.9 & 31.8 kDa under non-reducing conditions.
The CXCR4 protein exhibits multiple bands under both reducing (R) and non-reducing (NR) conditions. In R conditions, the band multiplicity likely stems from limited post-translational modification (PTM) variability (e.g., partial glycosylation or sulfation). Under NR conditions, the additional bands may arise from conformational heterogeneity, such as disulfide bond-mediated structural variations or oligomerization states stabilized in the absence of reducing agents (PubMed:10089882, 10756055).