Skip to the beginning of the images gallery

Recombinant Human Connexin 43/GJA1 Protein

COA

Grade & Purity:

Carrier Free

≥90%(SDS-PAGE)

Expression System: E. coli
Accession #: P17302
Protein Tag: C-His
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp175928

Grouped product items
SKU	Size	Availability	Price
rp175928-10μg	10μg	≥10	$99.90
rp175928-100μg	100μg	10	$499.90
rp175928-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,999.90

Carrier Free , ≥90% (SDS-PAGE), E. coli, C-His tag, 229-382 aa

View related series

Click to view protein information: GJA1

Accession#: P17302 (3) Connexin 43/GJA1 (1) Gene ID: 2697 (3) GJA1 (3)

Basic Description

Product Name	Recombinant Human Connexin 43/GJA1 Protein
Synonyms	gap junction protein, alpha 1, 43kDa \| GJA1 \| GJAL \| HSS \| ODD \| ODDD \| ODOD \| SDTY3 \| Connexin 43 \| connexin-43 \| CX43 \| CX43gap junction protein, alpha-like \| DFNB38 \| Gap junction alpha-1 protein \| Connexin-43 (Cx43) \| Gap junction 43 kDa heart protein
Grade	Carrier Free
Product Description	Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： Connexin 43/GJA1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. GJA1 is the major cardiac gap junction protein, which is thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. GJA1 is targeted by several protein kinases that regulate myocardial cell cell coupling. A related intronless GJA1 pseudogene, GJA1P, has been mapped to chromosome 5.
Specifications & Purity	Carrier Free, ≥90%(SDS-PAGE)
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	229-382 aa
Sequence	MFYVFFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEIHHHHHH
Protein Tag	C-His
Accession #	P17302
Predicted molecular weight	17.8 kDa
SDS-PAGE	18.2 kDa, under reducing conditions; 18.2 kDa, under non-reducing conditions
Molecule Type	Protein

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human Connexin 43/GJA1 Protein (rp175928)

Recombinant Human Connexin 43/GJA1 Protein (rp175928) - SDS-PAGE
2 μg/lane of Recombinant Human Connexin 43/GJA1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.2 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0707653	Certificate of Analysis	Jul 05, 2024	rp175928
ZJ24F0707652	Certificate of Analysis	Jul 05, 2024	rp175928

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration