Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp183573-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$169.90
|
|
|
rp183573-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$599.90
|
|
|
rp183573-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$899.90
|
|
|
rp183573-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$4,599.90
|
|
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 672-748 aa
| Product Name | Recombinant Human Complement Component C3a Protein |
|---|---|
| Synonyms | AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | HEL-S-62p | Anaphylatoxin | C3 | Complement Component C3a |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 672-748 aa |
| Sequence | SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR |
| Accession # | P01024 |
| Predicted molecular weight | 9.1 kDa |
| SDS-PAGE | 10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions. |
| Molecule Type | Protein |
| Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.