This is a demo store. No orders will be fulfilled.

Recombinant Human Complement Component C3a Protein

  • Accession #: P01024
  • Bioactivity: Testing in progress
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp183573
Grouped product items
SKU Size
Availability
Price Qty
rp183573-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$169.90
rp183573-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$599.90
rp183573-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$899.90
rp183573-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$4,599.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 672-748 aa

Basic Description

Product Name Recombinant Human Complement Component C3a Protein
Synonyms AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | HEL-S-62p | Anaphylatoxin | C3 | Complement Component C3a
Grade Carrier Free
Specifications & Purity Carrier Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar
Bioactivity Testing in progress
Endotoxin Concentration <1.0 EU/μg
Amino Acids 672-748 aa
Sequence SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR
Accession # P01024
Predicted molecular weight 9.1 kDa
SDS-PAGE 10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.
Molecule Type Protein

Associated Targets(Human)

C3 Tclin Complement C3 (0 Activities)
Activity Type Activity Value -log(M) Mechanism of Action Activity Reference Publications (PubMed IDs)

Storage and Shipping

Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.