Skip to the beginning of the images gallery

Recombinant Human CD14 Protein, ＞95%(SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: P08571,NP_000582.1
Protein Tag: C-His
Bioactivity: Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7‑23 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp143803

Grouped product items
SKU	Size	Availability	Price
rp143803-10μg	10μg	≥10	$59.90
rp143803-50μg	50μg	8	$139.90
rp143803-100μg	100μg	3	$239.90
rp143803-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,999.90

Animal Free, ＞95%(SDS-PAGE), Active, 293F, His tag, 20-352 aa

View related series

Click to view protein information: CD14

Accession#:NP_000582.1 (1) Accession#:P08571 (46) CD14 (50) Gene ID:929 (46)

Basic Description

Product Name	Recombinant Human CD14 Protein, ＞95%(SDS-PAGE), high purity
Synonyms	CD14 antigen \| CD14 molecule \| CD14 \| monocyte differentiation antigen CD14 \| Myeloid cell-specific leucine-rich glycoprotein \| CD_antigen=CD14 \| CD14_HUMAN \| LPS-R \| Mo2 \| Monocyte differentiation antigen CD14 urinary form \| Monocyte differentiation anti
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity： >95%(SDS-PAGE) Function： Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. Background： CD14 is a 55 kDa cell surface glycoprotein that is preferentially expressed on monocytes/macrophages. The human CD14 cDNA encodes a 375 amino acid (aa) residue precursor protein with a 19 aa signal peptide and a C-terminal hydrophobic region characteristic for glycosylphosphatidyinositol (GPI)-anchored proteins. Human CD14 has four potential N-linked glycosylation sites and also bears O-linked carbohydrates. The amino acid sequence of human CD14 is approximately 65% identical with the mouse, rat, rabbit, and bovine proteins. CD14 is a pattern recognition receptor that binds lipopolysaccharides (LPS) and a variety of ligands derived from different microbial sources. The binding of CD14 with LPS is catalyzed by LPS-binding protein (LBP). The toll-like-receptors have also been implicated in the transduction of CD14-LPS signals. Similar to other GPI-anchored proteins, soluble CD14 can be released from the cell surface by phosphatidyinositol-specific phospholipase C. Soluble CD14 has been detected in serum and body fluids. High concentrations of soluble CD14 have been shown to inhibit LPS-mediated responses. However, soluble CD14 can also potentiate LPS response in cells that do not express cell surface CD14.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity	＞95%(SDS-PAGE)
Bioactivity	Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7‑23 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	20-352 aa
Sequence	TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACHHHHHH
Protein Tag	C-His
Conjugation	Unconjugated
Accession #	P08571,NP_000582.1
Predicted molecular weight	37 kDa
SDS-PAGE	45-55 kDa
Molecule Type	Protein

Storage and Shipping

Shape	Lyophilized
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration 0f 0.1-1mg/mL. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles

Images

Protein Bioactivity: Recombinant Human CD14 Protein (rp143803)

Recombinant Human CD14 Protein (rp143803) - Protein Bioactivity
Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 12.3 ng/mL.

SDS-PAGE: Recombinant Human CD14 Protein (rp143803)

Recombinant Human CD14 Protein (rp143803) - SDS-PAGE
2.5 μg/lane of Recombinant Human CD14 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 47.7 kDa under reducing condition and 47.7 & 87.2 kDa under non-reducing condition.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1201897	Certificate of Analysis	Dec 13, 2023	rp143803
ZJ23F1201898	Certificate of Analysis	Dec 13, 2023	rp143803
ZJ23F1201899	Certificate of Analysis	Dec 13, 2023	rp143803

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration