This is a demo store. No orders will be fulfilled.

ProTx II,TFA, CAS No.484598-36-9(free base)

    Grade & Purity:
  • ≥95%
In stock
Item Number
P288852
Grouped product items
SKU Size
Availability
Price Qty
P288852-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$899.90
P288852-5mg
5mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,149.90

Selective NaV1.7 channel blocker

Basic Description

Product Name ProTx II,TFA, CAS No.484598-36-9(free base)
Specifications & Purity ≥95%
Sequence YCQKWMWTCDSERKCCEGMVCRLWCKKKLW(Modifications: Disulfide bridge: 2-16, 9-21, 15-25)
CAS 484598-36-9(free base)

Storage and Shipping

Storage Temp Protected from light,Store at -20°C,Argon charged
Shipped In Ice chest + Ice pads

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.