Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
P288852-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$899.90
|
|
|
P288852-5mg
|
5mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$3,149.90
|
|
Selective NaV1.7 channel blocker
| Product Name | ProTx II,TFA, CAS No.484598-36-9(free base) |
|---|---|
| Specifications & Purity | ≥95% |
| Sequence | YCQKWMWTCDSERKCCEGMVCRLWCKKKLW(Modifications: Disulfide bridge: 2-16, 9-21, 15-25) |
| CAS | 484598-36-9(free base) |
| Storage Temp | Protected from light,Store at -20°C,Argon charged |
|---|---|
| Shipped In | Ice chest + Ice pads |