This is a demo store. No orders will be fulfilled.

Phrixotoxin 3, CAS No.880886-00-0

In stock
Item Number
P288814
Grouped product items
SKU Size
Availability
Price Qty
P288814-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$1,003.90

Potent blocker of NaV1.2, NaV1.3 and NaV1.5 channels

Basic Description

Product Name Phrixotoxin 3, CAS No.880886-00-0
Biochemical and Physiological Mechanisms Potent blocker of voltage-gated sodium channels (IC50values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.
Sequence DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI(Modifications: Disulfide bridges: 2-17,9-23,16-30)
CAS 880886-00-0

Storage and Shipping

Storage Temp Store at -20°C
Shipped In Ice chest + Ice pads

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.