Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
P288814-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$1,003.90
|
|
Potent blocker of NaV1.2, NaV1.3 and NaV1.5 channels
| Product Name | Phrixotoxin 3, CAS No.880886-00-0 |
|---|---|
| Biochemical and Physiological Mechanisms | Potent blocker of voltage-gated sodium channels (IC50values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner. |
| Sequence | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI(Modifications: Disulfide bridges: 2-17,9-23,16-30) |
| CAS | 880886-00-0 |
| Storage Temp | Store at -20°C |
|---|---|
| Shipped In | Ice chest + Ice pads |