Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
Basic Description
| Product Name | GLP-1(7-36), amide TFA , CAS No.107444-51-9(free) |
|---|---|
| Synonyms | Glucagon-Like Peptide 1 (7-36) Amide trifluoroacetate salt |
| Specifications & Purity | ≥98% |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2 TFA |
| CAS | 107444-51-9(free) |
Storage and Shipping
| Storage Temp | Protected from light,Store at -20°C |
|---|---|
| Shipped In | Ice chest + Ice pads |
Certificates（CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 C23181312 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181311 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C2320021 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C2320024 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C2320022 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181296 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181306 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181307 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181308 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| C23181309 |
Certificate of Analysis | Mar 01, 2023 | G488919 |
| K2222492 |
Certificate of Analysis | Sep 14, 2022 | G488919 |
| K2222699 |
Certificate of Analysis | Sep 14, 2022 | G488919 |
| K2222700 |
Certificate of Analysis | Sep 14, 2022 | G488919 |
| K2222701 |
Certificate of Analysis | Sep 14, 2022 | G488919 |
| K2222785 |
Certificate of Analysis | Sep 14, 2022 | G488919 |
Show more⌵
Solution Calculators
Reviews
Customer Reviews
Remind me later