Skip to the beginning of the images gallery

Apelin-36 (rat, mouse), CAS No.230299-95-3

COA

In stock

Item Number

A288544

Grouped product items
SKU	Size	Availability	Price	Qty
A288544-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$192.90

Endogenous apelin agonist

View related series

Anti-infection (2803) Class A GPCR (4138) HIV (254) Virus (1811)

Basic Description

Product Name	Apelin-36 (rat, mouse), CAS No.230299-95-3
Biochemical and Physiological Mechanisms	Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50= 5.4 nM) and potently inhibits cAMP productionin vitro(EC50= 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and
Sequence	LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
CAS	230299-95-3

Storage and Shipping

Storage Temp	Store at -20°C,Desiccated
Shipped In	Ice chest + Ice pads

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration