Skip to the beginning of the images gallery

Recombinant Mouse TNF-alpha Protein, ＞97% (SDS-PAGE; HPLC ), high purity

Grade & Purity:

≥97%(SDS-PAGE&HPLC)

Expression System: E.coli
Accession #: P06804
Protein Tag: No tag
Bioactivity: Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED₅₀ for this effect is typically <0.1 ng/mL.
Endotoxin Concentration: <0.01 EU/μg

In stock

Item Number

rp154759

Grouped product items
SKU	Size	Availability	Price
rp154759-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$99.90
rp154759-20μg	20μg	≥10	$159.90
rp154759-50μg	50μg	3	$299.90
rp154759-100μg	100μg	1	$449.90
rp154759-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,569.90

Animal Free, >97% (SDS-PAGE; HPLC ), Active, E.coli, No tag, 80-235aa

View related series

Click to view protein information: TNF

Accession#:P06804 (2) Gene ID:21926 (2) TNF (18) TNF-alpha (9)

Basic Description

Product Name	Recombinant Mouse TNF-alpha Protein, ＞97% (SDS-PAGE; HPLC ), high purity
Synonyms	Recombinant Murine Tumor Necrosis Factor alpha (rMuTNF-α) \| APC1 protein \| Cachectin \| Cachetin \| DIF \| TNF \| TNF, monocyte-derived \| TNFA \| TNF-A \| TNFalpha \| TNF-alpha \| TNF-alphacachectin \| TNFATNF, macrophage-derived \| TNFG1F \| TNFSF1A \| TNFSF2 \| TNFS
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >97% (SDS-PAGE; HPLC). Purity is greater than 97% as determined by SEC-HPLC and reducing SDS-PAGE. Additional sequence information NP_038721. Mature protein; soluble form. Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Post-translational The soluble form derives from the membrane form by proteolytic processing. The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1. O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid. Tumor necrosis factor alpha (TNF-α), also called Cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. Human and murine TNF-α show approximately 79 % homology at the amino acid level and cross-reactivity between the two species. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types. The recombinant Murine TNF-α is a non-glycosylated polypeptide chain containing 157 amino acids
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC)
Purity	＞97% (SDS-PAGE; HPLC )
Bioactivity	Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED₅₀ for this effect is typically <0.1 ng/mL.
Endotoxin Concentration	<0.01 EU/μg
Expression System	E.coli
Species	Mouse
Amino Acids	80-235aa
Sequence	MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYL VYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPI YLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Protein Tag	No tag
Protein Length	Protein fragment
Accession #	P06804
Source	Recombinant
Predicted molecular weight	17.4 kDa

Storage and Shipping

Shape	Lyophilized
Reconstitution	1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration。 Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

Protein Bioactivity: Recombinant Mouse TNF-alpha Protein (rp154759)

Recombinant Mouse TNF-alpha Protein (rp154759)-Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The EC₅₀ for this effect is typically <0.1ng/mL.

SDS-PAGE: Recombinant Mouse TNF-alpha Protein (rp154759)

Recombinant Mouse TNF-alpha Protein (rp154759)-SDS-PAGE
3μg/lane of Recombinant Mouse TNF-alpha was resolved with SDS-PAGE under reducing (R) conditions and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.3 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101718	Certificate of Analysis	Nov 20, 2023	rp154759
ZJ23F1101717	Certificate of Analysis	Nov 20, 2023	rp154759
ZJ23F0300080	Certificate of Analysis	Mar 25, 2023	rp154759
ZJ23F0300081	Certificate of Analysis	Mar 25, 2023	rp154759
ZJ23F0300082	Certificate of Analysis	Mar 25, 2023	rp154759

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration