Skip to the beginning of the images gallery

Recombinant Mouse FGF basic/FGF2/bFGF Protein, ＞98%(SDS-PAGE), high purity

Grade & Purity:

≥98%(SDS-PAGE)

Expression System: E. coli
Accession #: P15655
Protein Tag: N-His
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp153964

Grouped product items
SKU	Size	Availability	Price
rp153964-10μg	10μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$66.90
rp153964-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$210.90
rp153964-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,806.90

Animal Free, >98%(SDS-PAGE), Active, E.coli, His, 11-154aa

View related series

Click to view protein information: FGF2

Accession#:P15655 (1) bFGF (5) FGF basic (6) FGF2 (9) Gene ID:14173 (1)

Basic Description

Product Name	Recombinant Mouse FGF basic/FGF2/bFGF Protein, ＞98%(SDS-PAGE), high purity
Synonyms	basic fibroblast growth factor bFGF \| Basic fibroblast growth factor \| bFGF \| FGF basic \| FGF2 \| FGF-2 \| FGFBprostatropin \| fibroblast growth factor 2 (basic) \| HBGF-2 \| heparin-binding growth factor 2 \| Prostatropin
Grade	Animal Free, Azide Free, Carrier Free
Product Description	FGF2, also known as a basic fibroblast growth factor (bFGF) and FGF-β, is a growth factor and signaling protein encoded by the FGF2 gene. FGF2 has been shown in preliminary animal studies to protect the heart from injury associated with a heart attack, reducing tissue death and promoting improved function after reperfusion. FGF-2 (bFGF) are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. Additionally, FGF-2 (bFGF) is frequently used for a critical component of cell culture medium, e.g., human embryonic stem cell culture medium, serum-free culture systems.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, ≥98%(SDS-PAGE)
Purity	＞98%(SDS-PAGE)
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Species	Mouse
Amino Acids	11-154 aa
Sequence	ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Protein Tag	N-His
N-terminal Sequence	His
Accession #	P15655
Predicted molecular weight	17.2 kDa
SDS-PAGE	17.2 kDa, under reducing conditions; 17.2 kDa, under non-reducing conditions.

Storage and Shipping

Shape	Lyophilized
Reconstitution	It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage Temp	Store at -80°C
Shipped In	Ice chest + Ice pads
Stability And Storage	Lyophilized protein should be stored at -20°C. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should

Images

SDS-PAGE: Recombinant Mouse FGF basic/FGF2/bFGF (rp153964)

Recombinant Mouse FGF basic/FGF2/bFGF (rp153964) - SDS-PAGE
3 μg/lane of Recombinant Mouse FGF basic/FGF2/bFGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.2 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0800926	Certificate of Analysis	Aug 30, 2023	rp153964
ZJ23F0800927	Certificate of Analysis	Aug 30, 2023	rp153964

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration