Skip to the beginning of the images gallery

Recombinant Human TNF-α Protein, >95% (SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: E. coli
Accession #: P01375
Protein Tag: N-His
Bioactivity: Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp156007

Grouped product items
SKU	Size	Availability	Price
rp156007-10μg	10μg	≥10	$99.90
rp156007-50μg	50μg	10	$259.90
rp156007-100μg	100μg	10	$379.90
rp156007-1mg	1mg	1	$1,999.90

Carrier Free, >95% (SDS-PAGE), Active, E.coli, His tag, 78-233 aa

View related series

Click to view protein information: TNF

Accession#:P01375 (15) Gene ID:7124 (15) TNF (18) TNF-α (2)

Basic Description

Product Name	Recombinant Human TNF-α Protein, >95% (SDS-PAGE), high purity
Synonyms	Cachectin \| TNF-a \| TNF-alpha \| Tumor necrosis factor ligand superfamily member 2 \| APC1 \| APC1 protein \| Cachectin \| DIF \| Differentiation inducing factor \| Macrophage cytotoxic factor \| Tnf \| TNF superfamily member 2 \| TNF superfamily, member 2 \| TNF, m
Grade	ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining Description: Tumor necrosis factor alpha (TNF-alpha), also known as cachectin and TNFSF2, is the prototypic ligand of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, immune system development, apoptosis, and lipid metabolism. Human TNF-alpha consists of a 35 amino acid (aa) cytoplasmic domain, a 21 aa transmembrane segment, and a 177 aa extracellular domain (ECD). Within the ECD, human TNF-alpha shares 97% aa sequence identity with rhesus and 71%-92% with bovine, canine, cotton rat, equine, feline, mouse, porcine, and rat TNF-alpha. TNF-alpha is produced by a wide variety of immune, epithelial, endothelial, and tumor cells. TNF-alpha is assembled intracellularly to form a noncovalently linked homotrimer which is expressed on the cell surface. Cell surface TNF-alpha can induce the lysis of neighboring tumor cells and virus-infected cells, and it can generate its own downstream cell signaling following ligation by soluble TNFR I. Shedding of membrane-bound TNF-alpha by TACE/ADAM17 releases the bioactive cytokine, a 55 kDa soluble trimer of the TNF-alpha extracellular domain. TNF-alpha binds the ubiquitous 55-60 kDa TNF RI and the hematopoietic cell-restricted 80 kDa TNF RII, both of which are also expressed as homotrimers. Both type I and type II receptors bind TNF-alpha with comparable affinity, although only TNF RI contains a cytoplasmic death domain which triggers the activation of apoptosis. Soluble forms of both types of receptors are released and can neutralize the biological activity of TNF-alpha.
Specifications & Purity	ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Bioactivity	Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	78-233 aa
Sequence	MGSSHHHHHHSSGLVPRGSHMRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Protein Tag	N-His
Accession #	P01375
Predicted molecular weight	19.5 kDa
SDS-PAGE	17.6 kDa, under reducing conditions；17.6 kDa, under non-reducing condition

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 20-100 pg/mL.

SDS-PAGE: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - SDS-PAGE
1.5 μg/lane of Recombinant Human TNF-α Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.6 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0303065	Certificate of Analysis	Mar 08, 2024	rp156007
ZJ24F0303064	Certificate of Analysis	Mar 08, 2024	rp156007
ZJ24F0303063	Certificate of Analysis	Mar 08, 2024	rp156007
ZJ24F0303062	Certificate of Analysis	Mar 08, 2024	rp156007
ZJ24R0200299	Certificate of Analysis	Feb 29, 2024	rp156007

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration